Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000482-TA|BGIBMGA000482-PA|undefined
         (239 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g17900.1 68417.m02668 zinc-binding family protein similar to ...    28   6.4  

>At4g17900.1 68417.m02668 zinc-binding family protein similar to
           zinc-binding protein [Pisum sativum] GI:16117799;
           contains Pfam profile PF04640 : Protein of unknown
           function, DUF597
          Length = 227

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 159 LGESPLPRPCQGRTQSCRPCSHIL---NFMFTKL-CVFSTFLRG 198
           L E P PRP +G T +C+ C   L   +F F  L C  +   RG
Sbjct: 124 LNERPQPRPGKGVTNTCKVCYRSLVDDSFRFCSLGCKIAGTSRG 167


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.323    0.138    0.449 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,896,556
Number of Sequences: 28952
Number of extensions: 170386
Number of successful extensions: 223
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 222
Number of HSP's gapped (non-prelim): 1
length of query: 239
length of database: 12,070,560
effective HSP length: 79
effective length of query: 160
effective length of database: 9,783,352
effective search space: 1565336320
effective search space used: 1565336320
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 58 (27.5 bits)