Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000478-TA|BGIBMGA000478-PA|IPR011047|Quinonprotein
alcohol dehydrogenase-like, IPR008940|Protein prenyltransferase
         (619 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    24   2.7  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 24.2 bits (50), Expect = 2.7
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 5/35 (14%)

Query: 567 YLEDYEIQLVVKG-----HCPFCRHPAEHLKNEDD 596
           ++   E Q +V G     HCPF  HP + +  E D
Sbjct: 513 FVRSMEKQAIVAGGTLIVHCPFAGHPVDSVVWERD 547


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.132    0.385 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,608
Number of Sequences: 317
Number of extensions: 5474
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 619
length of database: 114,650
effective HSP length: 61
effective length of query: 558
effective length of database: 95,313
effective search space: 53184654
effective search space used: 53184654
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)