BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000477-TA|BGIBMGA000477-PA|IPR001680|WD-40 repeat, IPR011046|WD40-like (363 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 4.1 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 7.2 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 233 TAEGVPIITTSQDWVWA 249 T G P++ DW WA Sbjct: 95 TGNGGPLLAPYPDWTWA 111 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 7.2 Identities = 10/36 (27%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 299 HLTTGNKVRIKCHDRVQKIAIYKHRLAVQLPERVVV 334 HL+TGN R+ C + + Y + + + +P ++V Sbjct: 201 HLSTGNYSRLACEIQFVRSMGY-YLIQIYIPSGLIV 235 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.323 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,808 Number of Sequences: 429 Number of extensions: 4214 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 363 length of database: 140,377 effective HSP length: 59 effective length of query: 304 effective length of database: 115,066 effective search space: 34980064 effective search space used: 34980064 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -