BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000477-TA|BGIBMGA000477-PA|IPR001680|WD-40 repeat, IPR011046|WD40-like (363 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.5 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 4.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.5 Identities = 7/34 (20%), Positives = 16/34 (47%) Query: 165 FRDKVGNEIQRILREAAVWAVAFSKMTLLVTDWN 198 + D GN+ R++ + A + + + +WN Sbjct: 2401 WNDSAGNKYSRLVNDPQARAAFIAHVLAFIEEWN 2434 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 22.6 bits (46), Expect = 4.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 227 GGWAILTAEGVPIITTSQDWVW 248 G WA +TA+ P+ + D W Sbjct: 205 GSWAGVTAQNSPLYASPLDGEW 226 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,739 Number of Sequences: 317 Number of extensions: 3243 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 363 length of database: 114,650 effective HSP length: 58 effective length of query: 305 effective length of database: 96,264 effective search space: 29360520 effective search space used: 29360520 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -