GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000477-TA|BGIBMGA000477-PA|IPR001680|WD-40 repeat,
IPR011046|WD40-like
         (363 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    23   10.0 

>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
            structural protein protein.
          Length = 1645

 Score = 23.4 bits (48), Expect = 10.0
 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 4/66 (6%)

Query: 48   RDGSLLQLLQAHKGAVHAVAYCGDGKKFASGSADRNVIIWTSKMEGILKYSHSEAIQCLA 107
            + GS  QLL     A ++      G+    G A  N    T    G+L   HS++ Q L 
Sbjct: 1197 KGGSETQLLHPPGTAPNSFHKSSPGRGSWPGPAVEN----TLGHNGLLDAEHSKSEQLLK 1252

Query: 108  YNPVTF 113
            YN   F
Sbjct: 1253 YNSARF 1258


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.323    0.135    0.421 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 382,619
Number of Sequences: 2123
Number of extensions: 15882
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 24
Number of HSP's gapped (non-prelim): 1
length of query: 363
length of database: 516,269
effective HSP length: 65
effective length of query: 298
effective length of database: 378,274
effective search space: 112725652
effective search space used: 112725652
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 48 (23.4 bits)