BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000477-TA|BGIBMGA000477-PA|IPR001680|WD-40 repeat, IPR011046|WD40-like (363 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 10.0 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 10.0 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Query: 48 RDGSLLQLLQAHKGAVHAVAYCGDGKKFASGSADRNVIIWTSKMEGILKYSHSEAIQCLA 107 + GS QLL A ++ G+ G A N T G+L HS++ Q L Sbjct: 1197 KGGSETQLLHPPGTAPNSFHKSSPGRGSWPGPAVEN----TLGHNGLLDAEHSKSEQLLK 1252 Query: 108 YNPVTF 113 YN F Sbjct: 1253 YNSARF 1258 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 382,619 Number of Sequences: 2123 Number of extensions: 15882 Number of successful extensions: 24 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 24 Number of HSP's gapped (non-prelim): 1 length of query: 363 length of database: 516,269 effective HSP length: 65 effective length of query: 298 effective length of database: 378,274 effective search space: 112725652 effective search space used: 112725652 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -