GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000476-TA|BGIBMGA000476-PA|undefined
         (153 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z69977-1|CAA93817.1|  151|Anopheles gambiae ribosomal protein RS...    22   7.5  

>Z69977-1|CAA93817.1|  151|Anopheles gambiae ribosomal protein RS11
           protein.
          Length = 151

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 9/33 (27%), Positives = 18/33 (54%)

Query: 44  YRTYGNGDVKTLERHLSMKKTIRKKIMRDLQQA 76
           +R    GD+ TL     + KT+R  ++++ + A
Sbjct: 110 FRDVEAGDIVTLGECRPLSKTVRFNVLKESKMA 142


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 128,202
Number of Sequences: 2123
Number of extensions: 4409
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 153
length of database: 516,269
effective HSP length: 59
effective length of query: 94
effective length of database: 391,012
effective search space: 36755128
effective search space used: 36755128
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 44 (21.8 bits)