SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000476-TA|BGIBMGA000476-PA|undefined
         (153 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-1516|AAN10669.1| 1005|Drosophila melanogaster CG31897-P...    28   6.3  

>AE014134-1516|AAN10669.1| 1005|Drosophila melanogaster CG31897-PA
           protein.
          Length = 1005

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 51  DVKTLERHLSMKKTIRKKIMRDLQQAFVEDPNEFKVENTSPEKLKAELSAEAVKIEKNVR 110
           +VK+  +H+  ++ +R K +  +    ++DPNE      S ++    L A  +K++   R
Sbjct: 185 NVKSSRKHIHRRRIVRPKQLNPINFDLLKDPNE-----VSQKRSIHNLPASRLKVKVYPR 239

Query: 111 KNDPTF 116
           K   T+
Sbjct: 240 KKIETY 245


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,452,778
Number of Sequences: 52641
Number of extensions: 207716
Number of successful extensions: 659
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 659
Number of HSP's gapped (non-prelim): 1
length of query: 153
length of database: 24,830,863
effective HSP length: 79
effective length of query: 74
effective length of database: 20,672,224
effective search space: 1529744576
effective search space used: 1529744576
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 58 (27.5 bits)

- SilkBase 1999-2023 -