GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000474-TA|BGIBMGA000474-PA|IPR002917|GTP-binding
protein, HSR1-related, IPR005289|GTP-binding, IPR006073|GTP1/OBG
         (586 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    23   4.4  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 23.4 bits (48), Expect = 4.4
 Identities = 12/48 (25%), Positives = 21/48 (43%)

Query: 312  LDSKIKILDSPGIVFQSGPESDSTVALKNAIRVGSLKDPVTPATAILQ 359
            L   IK   + G+  Q   ++  T      IRV  +  P+T A  +++
Sbjct: 1087 LSDDIKAYTAEGVPEQPPDKATCTTLTAQTIRVSWVSPPLTAANGVIK 1134


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.314    0.131    0.364 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,871
Number of Sequences: 317
Number of extensions: 4061
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 586
length of database: 114,650
effective HSP length: 61
effective length of query: 525
effective length of database: 95,313
effective search space: 50039325
effective search space used: 50039325
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 46 (22.6 bits)