BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000473-TA|BGIBMGA000473-PA|IPR004859|Putative 5-3 exonuclease (1120 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 25 2.9 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 25 2.9 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 25.0 bits (52), Expect = 2.9 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 1005 DKQLEILNANERKITMQ-VKWNLLYKAELH 1033 D L + N N +T++ KWNLL+K H Sbjct: 142 DVTLWLSNVNSLTLTLKRKKWNLLFKTLTH 171 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 25.0 bits (52), Expect = 2.9 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 1005 DKQLEILNANERKITMQ-VKWNLLYKAELH 1033 D L + N N +T++ KWNLL+K H Sbjct: 68 DVTLWLSNVNSLTLTLKRKKWNLLFKTLTH 97 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 258,491 Number of Sequences: 317 Number of extensions: 11158 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 32 Number of HSP's gapped (non-prelim): 2 length of query: 1120 length of database: 114,650 effective HSP length: 64 effective length of query: 1056 effective length of database: 94,362 effective search space: 99646272 effective search space used: 99646272 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -