BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000471-TA|BGIBMGA000471-PA|undefined (204 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0135 - 989616-989702,990746-991013,991229-991566 29 2.6 04_04_0995 + 29985473-29985625,29986372-29986446,29986537-299870... 29 2.6 >07_01_0135 - 989616-989702,990746-991013,991229-991566 Length = 230 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 113 PPNMCSNDGVDLLMRRSKDFPGILSPKIEIATKVRIDEVWNQSCVGHFKQTPCHC 167 P CS++ VD+L + G+ P+ A +V+ +W + + TPC+C Sbjct: 38 PVCQCSDNPVDVLFGQRTATSGLWKPQ---AWEVQRRRIWQRQVQFGYSCTPCNC 89 >04_04_0995 + 29985473-29985625,29986372-29986446,29986537-29987044, 29987349-29987734,29988418-29988641,29988728-29988893, 29989095-29989226 Length = 547 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Query: 30 SLSVYALGTSYQTCMLPPIFPLTFKDVFYFRKRFQETCALNNICCLLKDETIYCE 84 + SV L TC++PP +P F ++ +T ++++C +L +TI+ + Sbjct: 108 TFSVQHLAPISFTCLMPPSYPSHHAPYFTLSSQWLDTVKVSSLCLML--DTIWSQ 160 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.325 0.139 0.453 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,696,573 Number of Sequences: 37544 Number of extensions: 227930 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 475 Number of HSP's gapped (non-prelim): 2 length of query: 204 length of database: 14,793,348 effective HSP length: 79 effective length of query: 125 effective length of database: 11,827,372 effective search space: 1478421500 effective search space used: 1478421500 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -