BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000470-TA|BGIBMGA000470-PA|IPR002933|Peptidase M20, IPR011650|Peptidase dimerisation, IPR010159|N-acyl-L-amino-acid amidohydrolase, IPR001261|ArgE/dapE/ACY1/CPG2/yscS (398 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 23 3.8 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 23 3.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 5.1 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 371 AHNERVHADMYKKGIDIMEKVLE 393 A E ++ D +KK ID ++KVL+ Sbjct: 128 ARFEDINMDYFKKCIDPVDKVLQ 150 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 371 AHNERVHADMYKKGIDIMEKVLE 393 A E ++ D +KK ID ++KVL+ Sbjct: 128 ARFEDINMDYFKKCIDPVDKVLQ 150 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 5.1 Identities = 20/77 (25%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Query: 156 SESQEFKNLNVGFGMDESAPSPEPDELIVFNGERTSRQVKVTCKGEPGHGALLDIDNAGE 215 +E+ F + G+G+ P P P G S V V C G G+ Sbjct: 186 AETASFHHDAAGYGLRNYGPEPVPSTPYPPPGSLGSMGVSVPC-GTSGNPLEWTGQVTVR 244 Query: 216 KFYTILSKFMSLRAEEK 232 K SKF +L E++ Sbjct: 245 KKRKPYSKFQTLELEKE 261 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,362 Number of Sequences: 317 Number of extensions: 4176 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 398 length of database: 114,650 effective HSP length: 58 effective length of query: 340 effective length of database: 96,264 effective search space: 32729760 effective search space used: 32729760 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -