BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000466-TA|BGIBMGA000466-PA|IPR002126|Cadherin (460 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0460 + 4059640-4059810,4059904-4060038,4060157-4060240,406... 33 0.63 05_01_0294 - 2291175-2291223,2291591-2292039,2292143-2292211,229... 30 3.4 >08_01_0460 + 4059640-4059810,4059904-4060038,4060157-4060240, 4061068-4061097,4062183-4062227,4062352-4062417 Length = 176 Score = 32.7 bits (71), Expect = 0.63 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 1/121 (0%) Query: 318 VDSDHRLKIVYHHKELNDTDIAKRVKRELRNQSPYFEQALYVASVAEEQPPGVIVTTVKA 377 V+ D +I+ H K + T I + +L + + Y EE V+ + Sbjct: 32 VEMDLLQRILPHCKMEDLTRIENNTEMDLTPVTDKLWKLFYTRQFGEENANQVVKRMSMS 91 Query: 378 RSRKQSRDIFDVKSTRLEIGWHVRCGHEIGRGDHTSKAGSRETRCTLLQGCGSRRHLSAK 437 +R + +D+FD K T+ + + + G + + +KAG + LQ G +K Sbjct: 92 GARYKWKDLFDAK-TKKQKEYEEKMGQRLAKKYEAAKAGKKHFLAGCLQISGKNESCYSK 150 Query: 438 K 438 + Sbjct: 151 E 151 >05_01_0294 - 2291175-2291223,2291591-2292039,2292143-2292211, 2292397-2292449,2292492-2294478 Length = 868 Score = 30.3 bits (65), Expect = 3.4 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Query: 304 VSILFTFNCDQTYIVDSDHRLKIVYHHKELNDTD-IAKRVKRELRNQSPYFEQALYVASV 362 +S F FN Y + LKI+ ++K N + IA VK L+ F + L V+++ Sbjct: 158 LSYYFLFNAGIKYKLFDPSGLKIILNYKRCNYLEFIAGNVKATLQMHLVTFAKKLAVSNM 217 Query: 363 AEEQPPGV 370 A+++ GV Sbjct: 218 ADDKLLGV 225 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.322 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,961,023 Number of Sequences: 37544 Number of extensions: 527273 Number of successful extensions: 1253 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1253 Number of HSP's gapped (non-prelim): 2 length of query: 460 length of database: 14,793,348 effective HSP length: 85 effective length of query: 375 effective length of database: 11,602,108 effective search space: 4350790500 effective search space used: 4350790500 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -