BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000466-TA|BGIBMGA000466-PA|IPR002126|Cadherin (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) 37 0.039 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_18678| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 33 0.48 SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) 32 0.84 SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.84 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.6 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 31 2.6 SB_4448| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.6 SB_51779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_5412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 30 4.5 SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 >SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2418 Score = 36.7 bits (81), Expect = 0.039 Identities = 15/28 (53%), Positives = 17/28 (60%) Query: 351 PYFEQALYVASVAEEQPPGVIVTTVKAR 378 PYF Q +Y+A V E QP G VT V R Sbjct: 587 PYFSQPIYIAQVPENQPSGTFVTVVVGR 614 Score = 29.5 bits (63), Expect = 5.9 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Query: 307 LFTFNCDQTYIVDSDHRLKIVYHHKELNDTDIAKRVKRELRNQS---PYFEQALYVASVA 363 L F DQT + LK+ + + D VK ++ N + PYF+Q LY + Sbjct: 1925 LLDFERDQT-----QYNLKVKATEQIPDGLDSTVDVKIDVINANDHFPYFDQQLYSVQIP 1979 Query: 364 EEQPPGVIVTTVKAR 378 E GV+V V A+ Sbjct: 1980 ESTAVGVLVQEVTAK 1994 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 36.3 bits (80), Expect = 0.052 Identities = 17/44 (38%), Positives = 27/44 (61%) Query: 340 KRVKRELRNQSPYFEQALYVASVAEEQPPGVIVTTVKARSRKQS 383 K + ++++ P FE+ LY +V E+ PP V TVKA+S+ S Sbjct: 960 KVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLS 1003 >SB_18678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 344 RELRNQSPYFEQALYVASVAEEQPPGVIVTTVKA 377 R+ + SP F +ALY + + E +PPG V V A Sbjct: 409 RDENDNSPIFSRALYSSPIYENEPPGTFVIQVSA 442 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 33.1 bits (72), Expect = 0.48 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 319 DSDHRLKIVYHHKELNDTDIAKRVKRELRNQSPYFEQALYVASVAEEQPPGVIVTTVKAR 378 D +++ K++Y+ + D D ++ + P F Q+ Y A V E P G V V A Sbjct: 76 DLEYKGKVIYN---ITDGDENLIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHAS 132 Query: 379 SRKQ 382 R Q Sbjct: 133 DRDQ 136 >SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2225 Score = 32.3 bits (70), Expect = 0.84 Identities = 13/35 (37%), Positives = 23/35 (65%) Query: 343 KRELRNQSPYFEQALYVASVAEEQPPGVIVTTVKA 377 ++E + +P F ++LY+A+++E P V TVKA Sbjct: 366 QKECNDVAPAFNRSLYLATISESTPVDTAVVTVKA 400 >SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 32.3 bits (70), Expect = 0.84 Identities = 22/95 (23%), Positives = 39/95 (41%), Gaps = 4/95 (4%) Query: 256 LTAFLPRTVQKMCKVQFLDVSDPRFLIENSQGDLVAADDVCIQEPMWKVS----ILFTFN 311 LTA +P ++ KV+FL VS + + D++ + C P + + + F Sbjct: 222 LTASVPLDAEQDTKVEFLGVSSTNGSVAIAIDDIMITTENCTTSPAYAATGYKCASYEFQ 281 Query: 312 CDQTYIVDSDHRLKIVYHHKELNDTDIAKRVKREL 346 C + + R Y+ + +D D K EL Sbjct: 282 CTSGHCISGSSRCDSDYNCMDSSDEDGCKCFTNEL 316 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 332 ELNDTDIAKRVKR-ELRNQSPYFEQALYVASVAEEQPPGVIVTTVKARSRKQSRD 385 +LN T + + + + +P F +A Y A V+EE G V V A R +D Sbjct: 1742 QLNSTTLHLNISLVDANDNNPTFTKAAYTAHVSEEATAGTNVIMVNATERDSGKD 1796 Score = 29.9 bits (64), Expect = 4.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 345 ELRNQSPYFEQALYVASVAEEQPPGVIVTTVKAR 378 + + P F Q+ Y A+V E P G VT V AR Sbjct: 3071 DFNDNQPQFNQSEYSATVLENMPVGTKVTMVTAR 3104 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 30.7 bits (66), Expect = 2.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Query: 345 ELRNQSPYFEQALYVASVAEEQPPGVIVTTVKARSR 380 +L + P F++A++ AS+AE G VT V A R Sbjct: 5401 DLNDNPPAFDKAVFNASIAENSESGASVTRVTASDR 5436 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 30.7 bits (66), Expect = 2.6 Identities = 13/46 (28%), Positives = 27/46 (58%) Query: 332 ELNDTDIAKRVKRELRNQSPYFEQALYVASVAEEQPPGVIVTTVKA 377 +L+ T +A + + +P F + ++ +V+E+ PG +VT+V A Sbjct: 2207 KLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSA 2252 >SB_4448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 30.7 bits (66), Expect = 2.6 Identities = 13/46 (28%), Positives = 27/46 (58%) Query: 332 ELNDTDIAKRVKRELRNQSPYFEQALYVASVAEEQPPGVIVTTVKA 377 +L+ T +A + + +P F + ++ +V+E+ PG +VT+V A Sbjct: 38 KLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSA 83 >SB_51779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3610 Score = 30.3 bits (65), Expect = 3.4 Identities = 15/62 (24%), Positives = 27/62 (43%) Query: 316 YIVDSDHRLKIVYHHKELNDTDIAKRVKRELRNQSPYFEQALYVASVAEEQPPGVIVTTV 375 Y + +L++ + +D + + +P F + +Y S+ EE P G V TV Sbjct: 1842 YETQREFKLRLTISDGKTSDFGFLTIKVTDANDNAPLFSKLVYEVSLREESPAGTSVVTV 1901 Query: 376 KA 377 A Sbjct: 1902 SA 1903 >SB_5412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 30.3 bits (65), Expect = 3.4 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Query: 88 NLFTFYVDSTSERIRDIDYYSLPIRILVTGEDCSRRHADLYDIDFDRVYDQNDAALQYED 147 N+ Y DS E + D D I +D ++L D+ D V D N+ Y+D Sbjct: 73 NIEDVYDDSNIEDVYD-DSVDDDNNIEDYYDDSVDDDSNLEDVYDDSVDDDNNIEDVYDD 131 Query: 148 SYTIRDKREVVYQESID 164 S + EVVY +S+D Sbjct: 132 SVDDDNNIEVVYDDSVD 148 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 348 NQSPYFEQALYVASVAEEQPPGVIVTTVKARSR 380 + +P F Q Y+ S+AE PGV + V A R Sbjct: 231 DHAPVFTQNSYLGSIAENTKPGVSILRVSAADR 263 >SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2126 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 93 YVDSTSERIRDIDYYS-LPIRILVTGEDCSRRHADLYD 129 Y D + I+D+DY L + +++ DCS H LYD Sbjct: 431 YHDPEYDSIQDLDYEDELDLVAVLSSRDCSTGHIGLYD 468 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 29.5 bits (63), Expect = 5.9 Identities = 25/116 (21%), Positives = 48/116 (41%), Gaps = 12/116 (10%) Query: 303 KVSILFTFNCDQTYIVDSDHRLKIVYHHKELNDTDIAKRV-----KRELRNQSPYFEQAL 357 K + NC + + R +I+ + +N+ ++K + K + + PY E+A Sbjct: 5 KTHVKRPMNCFMVW--SREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAK 62 Query: 358 YVASVAEEQPPGVIVTTVKARSRKQSRDIFDVKSTRLEIGWHVRCGHEIGRGDHTS 413 ++ + +E+ P + +S+ FD + L I CG GRG S Sbjct: 63 HLTEMHKEKHPDYKYQPKRRKSKSSKEKGFDAQGVALNIS--SACG---GRGSEDS 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.322 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,278,337 Number of Sequences: 59808 Number of extensions: 637592 Number of successful extensions: 1691 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 1615 Number of HSP's gapped (non-prelim): 77 length of query: 460 length of database: 16,821,457 effective HSP length: 85 effective length of query: 375 effective length of database: 11,737,777 effective search space: 4401666375 effective search space used: 4401666375 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -