BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000462-TA|BGIBMGA000462-PA|IPR009832|Protein of unknown function DUF1397 (227 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41150.1 68418.m05002 repair endonuclease (RAD1) (UVH1) conta... 33 0.12 At5g12370.1 68418.m01455 exocyst complex component Sec10-related... 32 0.28 At4g15830.1 68417.m02408 expressed protein 32 0.37 At1g22060.1 68414.m02759 expressed protein 31 0.48 At1g71210.1 68414.m08217 pentatricopeptide (PPR) repeat-containi... 29 2.6 At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) fa... 29 3.4 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 29 3.4 At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase, put... 28 4.5 At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 28 4.5 At5g41050.1 68418.m04990 expressed protein 28 6.0 At4g38070.1 68417.m05377 bHLH family protein contains Pfam profi... 28 6.0 At3g25610.1 68416.m03188 haloacid dehalogenase-like hydrolase fa... 27 7.9 At1g77080.2 68414.m08975 MADS-box protein AGL27-II (AGL27) / MAD... 27 7.9 At1g13210.1 68414.m01532 haloacid dehalogenase-like hydrolase fa... 27 7.9 >At5g41150.1 68418.m05002 repair endonuclease (RAD1) (UVH1) contains Pfam PF02732 : ERCC4 domain; contains TIGRFAM TIGR00596: DNA repair protein (rad1); almost identical to 5' repair endonuclease (GI:8926611) [Arabidopsis thaliana] Length = 956 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/47 (34%), Positives = 25/47 (53%) Query: 150 KTENLKTCFLNLKQSFPTVESANNLSLVEKCAKVDEMTSCIVKSLEE 196 + EN T + + P V AN S++EKC + E+ S V++L E Sbjct: 887 RAENYNTSAVEFLRRLPGVSDANYRSIMEKCKSLAELASLPVETLAE 933 >At5g12370.1 68418.m01455 exocyst complex component Sec10-related low similarity to SP|O00471 Exocyst complex component Sec10 (hSec10) {Homo sapiens} Length = 858 Score = 32.3 bits (70), Expect = 0.28 Identities = 34/100 (34%), Positives = 47/100 (47%), Gaps = 14/100 (14%) Query: 41 PEVEAALRTFGNCLKGLVD--------LNVLKTEI--EEAKPNGALDEVFKKYCDKSAQL 90 PEV+ L F + K LVD LN LK E+ +++K L E + A+L Sbjct: 87 PEVDGLLSLFKDACKELVDLRKQVDGRLNTLKKEVSTQDSKHRKTLTEGVDGLFESFARL 146 Query: 91 KGCISSVLQGVRPCVGNEYANHINDAQNST-NQLIDFVCY 129 G ISSV Q +G+ + DAQ T +Q ID + Y Sbjct: 147 DGRISSVGQTAAK-IGDHLQS--ADAQRETASQTIDLIKY 183 >At4g15830.1 68417.m02408 expressed protein Length = 296 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Query: 18 DDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVDLNVLKTEIEEAKPNGALD 77 ++ + ++ +Q + DK+PE A R+ N L N EE G+ Sbjct: 217 NEMEEFGMILLAQMAADQLSDKLPEAREAARSMVNSLFEKFTWN------EEEDEEGSKQ 270 Query: 78 EVFKKYCDKS 87 E +KK+C+K+ Sbjct: 271 EAWKKFCEKN 280 >At1g22060.1 68414.m02759 expressed protein Length = 1999 Score = 31.5 bits (68), Expect = 0.48 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 6/112 (5%) Query: 108 EYANHINDAQNSTNQLIDFVCYKDGDRIALFIAEGGPECFQQKTENLKTC---FLNLKQS 164 EY + + + +L F C D +F C + E L C L ++ Sbjct: 1334 EYVRNAHRESSFIEEL--FQCLMAADVQLIFTKIQSDICINEFAEQLSCCSNSHLEFQKK 1391 Query: 165 FPTVESANNLSLVEKCAKVDEMTSCIVKSLEECSTPTPANMAESLIKFMRKD 216 + VESA N LV + +DE ++ +LE + ++MA+S R D Sbjct: 1392 YTDVESALNHCLVNETRYMDENNQLLI-NLEVLKSELESSMAKSRALADRND 1442 >At1g71210.1 68414.m08217 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 879 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 8 ITIFAAGVLADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVDLNVLKTEI 67 IT F VL + + V + N EDK+PE+++ G G +D+ V + Sbjct: 740 ITAFIGNVLLHNAMKSKGVYEAWTRMRNIEDKIPEMKSLGELIG-LFSGRIDMEVELKRL 798 Query: 68 EE 69 +E Sbjct: 799 DE 800 >At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 396 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/44 (31%), Positives = 23/44 (52%) Query: 76 LDEVFKKYCDKSAQLKGCISSVLQGVRPCVGNEYANHINDAQNS 119 LD F+ + + G I +LQG+R + +EY + N+ NS Sbjct: 136 LDREFESILRRRRRSSGNILQLLQGIRAGIASEYESSDNNWDNS 179 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/72 (19%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Query: 148 QQKTENLKTCFLNLKQSFPTVESANNLSLVEKCAKVDEMTSCIVKSLEECSTPTPANMAE 207 +++ E L F+ L++ P++ + +S+++ + + V+ LE C T Sbjct: 447 KKRREKLNERFMTLRKIIPSINKIDKVSILDDTIEYLQELERRVQELESCRESTDTETRG 506 Query: 208 SLIKFMRKDSPC 219 ++ M++ PC Sbjct: 507 TMT--MKRKKPC 516 >At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative similar to SP:O04130 from [Arabidopsis thaliana] Length = 588 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 151 TENLKTCFLNLKQSFPTVESANNLSLVEKCAKVDEMTSCIVKS 193 TE L ++L + + V+ + +LSL E C K+ + IV+S Sbjct: 52 TEKLGQAGIDLLKKYANVDCSYDLSLEELCTKISLCDALIVRS 94 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 16 LADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVD 59 +AD QI+AV + T +A + V A ++G+C L + Sbjct: 1443 MADSSGQISAVAMERLTAASAAEPYESVSCAFVSYGSCAMDLAE 1486 >At5g41050.1 68418.m04990 expressed protein Length = 172 Score = 27.9 bits (59), Expect = 6.0 Identities = 21/82 (25%), Positives = 33/82 (40%), Gaps = 3/82 (3%) Query: 57 LVDLNVLKTEIEEAKPNGALDEVFKKYCDKSAQLKGCISSVLQGVRPCVGNEYANHINDA 116 L+ LN L + AKPNG + + YCD + S P V N A Sbjct: 14 LLSLNSLSLKHSSAKPNGKITVMGLVYCDVCSNNSFSNHSYF---IPGVEVRIICRFNSA 70 Query: 117 QNSTNQLIDFVCYKDGDRIALF 138 + T ++I F + + + L+ Sbjct: 71 SSRTREMITFSANRTTNELGLY 92 >At4g38070.1 68417.m05377 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; PMID: 12679534; putative bHLH131 transcription factor Length = 1513 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/53 (22%), Positives = 31/53 (58%) Query: 147 FQQKTENLKTCFLNLKQSFPTVESANNLSLVEKCAKVDEMTSCIVKSLEECST 199 +++ E + C + L++ +ES +N ++ E C+KVD + + + +E+ ++ Sbjct: 595 YKEMLEESEKCRVLLEEQISQLESDSNENIRELCSKVDIAYAKLAEEVEKTAS 647 >At3g25610.1 68416.m03188 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Mus musculus [SP|P98200, SP|P70704], {Bos taurus} SP|Q29449; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1202 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 206 AESLIKFMRKDSPCHTALPKTD 227 A L KF R + CHTA+P+TD Sbjct: 509 AAVLQKFFRLLAVCHTAIPETD 530 >At1g77080.2 68414.m08975 MADS-box protein AGL27-II (AGL27) / MADS affecting flowering 1 (MAF1) contains similarity to MADS box transcription factor GI:3688591 from [Triticum aestivum]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); contains Pfam domain PF01486: K-box region Length = 192 Score = 27.5 bits (58), Expect = 7.9 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 2/82 (2%) Query: 132 GDRIALFIAEGGPECFQQKTENLKTCFLNLKQSFPTVESANNLSLVEKCAKVDEMTSCIV 191 GD I P+CF+ E +L K+ TV+S V+ VD + S + Sbjct: 60 GDEIEALFKPEKPQCFELDLEEKIQNYLPHKELLETVQSKLEEPNVDN-VSVDSLIS-LE 117 Query: 192 KSLEECSTPTPANMAESLIKFM 213 + LE + + A AE +++++ Sbjct: 118 EQLETALSVSRARKAELMMEYI 139 >At1g13210.1 68414.m01532 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) (Chromaffin granule ATPase) from {Homo sapiens} SP|Q9Y2Q0, {Mus musculus} SP|P98200, {Bos taurus} SP|Q29449; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase; ESTs gb|T45045 and gb|AA394473 come from this gene Length = 1203 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 206 AESLIKFMRKDSPCHTALPKTD 227 A L KF R + CHTA+P+TD Sbjct: 508 AAVLQKFFRLLAVCHTAIPETD 529 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.131 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,338,227 Number of Sequences: 28952 Number of extensions: 212595 Number of successful extensions: 625 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 616 Number of HSP's gapped (non-prelim): 16 length of query: 227 length of database: 12,070,560 effective HSP length: 79 effective length of query: 148 effective length of database: 9,783,352 effective search space: 1447936096 effective search space used: 1447936096 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -