BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000461-TA|BGIBMGA000461-PA|undefined (377 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 27 0.29 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.6 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 26.6 bits (56), Expect = 0.29 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Query: 320 HP-SVSS---GVAYQPPVSRHLSIHPQQHNNMQGPKPGSITQGYPVQQSNQNPNMYPSRH 375 HP S+SS + + P+S HL P + P SI + P +S + MY H Sbjct: 335 HPLSLSSDHQAMLHHNPMSHHLKQEPSGFTSSN--HPFSINRLLPTAESKADIKMYADMH 392 Query: 376 RY 377 +Y Sbjct: 393 QY 394 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 340 HPQQHNNMQGPKPGSITQGYPVQQSNQNPNMYPSR 374 HP + + P P S P Q+++ + Y SR Sbjct: 65 HPWKKSPQGAPSPSSTPSSLPTQRTSTSNPTYSSR 99 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.131 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,245 Number of Sequences: 317 Number of extensions: 2156 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 377 length of database: 114,650 effective HSP length: 58 effective length of query: 319 effective length of database: 96,264 effective search space: 30708216 effective search space used: 30708216 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -