BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000456-TA|BGIBMGA000456-PA|IPR001680|WD-40 repeat, IPR011046|WD40-like, IPR000209|Peptidase S8 and S53, subtilisin, kexin, sedolisin (1448 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 29 0.17 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 2.8 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 25 5.0 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 29.5 bits (63), Expect = 0.17 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 325 VQNCYYFLDAIEESPENKCYGDYIDGAFDNLEVVFGSKAFSKLAS 369 + N Y F D ++ S +N+C G ID A N VF K + AS Sbjct: 202 IDNSYQFCDNLQYSFDNQCSGT-IDWALPNKRTVFIRKGGTAKAS 245 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.4 bits (53), Expect = 2.8 Identities = 12/40 (30%), Positives = 21/40 (52%) Query: 1153 SMDMSLKVWKLDGGKLSQVLVGHSDIVTCVAVSITNKTQV 1192 S+D ++K W G S++++G + TN+TQV Sbjct: 395 SVDYAVKFWTKKGFPKSKIVLGVPFFGRSFTLQFTNETQV 434 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 24.6 bits (51), Expect = 5.0 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 325 VQNCYYFLDAIEESPENKCYGDYIDGAFDNLEVVF 359 + N Y F D ++ S +N+C G ID A E F Sbjct: 193 IDNSYQFCDNLQYSFDNQCSGT-IDWALPKQEDCF 226 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.133 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 310,569 Number of Sequences: 317 Number of extensions: 12242 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 4 length of query: 1448 length of database: 114,650 effective HSP length: 66 effective length of query: 1382 effective length of database: 93,728 effective search space: 129532096 effective search space used: 129532096 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -