BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000453-TA|BGIBMGA000453-PA|undefined (80 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 0.27 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 0.46 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 0.61 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 2.5 AY078399-1|AAL83702.1| 31|Apis mellifera major royal jelly pro... 20 4.3 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 20 4.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 19 5.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 19 5.7 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 19 5.7 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 19 5.7 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 19 7.6 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 19 7.6 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 19 7.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 0.27 Identities = 10/21 (47%), Positives = 11/21 (52%), Gaps = 1/21 (4%) Query: 53 CWCKPGLIRDSIAHKCVKECP 73 C CKPG D +C ECP Sbjct: 247 CHCKPGYQADVEKQECT-ECP 266 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.0 bits (47), Expect = 0.46 Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Query: 51 CDCWCKPGLIRDSIAHKC---VKECPKYDEILD 80 C C+PG+I+ C +C +Y+ + D Sbjct: 539 CSLPCEPGMIKKQQGDTCCWVCDQCEEYEYVYD 571 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 0.61 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 51 CDCWCKPGLIRDSIAHKCVKECPKYDE 77 C C+PG+I+ C C + +E Sbjct: 449 CSLPCEPGMIKKQQGDTCCWVCDQCEE 475 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 20.6 bits (41), Expect = 2.5 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 41 RSAHSNRKHYCDCWCKPGLIRDSIAH 66 R A +NRK KPG I ++IAH Sbjct: 375 RKARANRKPNLGD-IKPGSIIENIAH 399 >AY078399-1|AAL83702.1| 31|Apis mellifera major royal jelly protein MRJP2 protein. Length = 31 Score = 19.8 bits (39), Expect = 4.3 Identities = 6/10 (60%), Positives = 10/10 (100%) Query: 8 LFIISCLGIS 17 LF+++CLGI+ Sbjct: 5 LFMVACLGIA 14 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 19.8 bits (39), Expect = 4.3 Identities = 6/10 (60%), Positives = 10/10 (100%) Query: 8 LFIISCLGIS 17 LF+++CLGI+ Sbjct: 5 LFMVACLGIA 14 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 19.4 bits (38), Expect = 5.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 3 LWFVLLFIISCLGIS 17 L++ + II C+GIS Sbjct: 245 LFYTVNIIIPCMGIS 259 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 19.4 bits (38), Expect = 5.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 3 LWFVLLFIISCLGIS 17 L++ + II C+GIS Sbjct: 245 LFYTVNIIIPCMGIS 259 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 19.4 bits (38), Expect = 5.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 3 LWFVLLFIISCLGISSAE 20 +W VL+ I C G A+ Sbjct: 9 MWIVLVLISGCSGNPDAK 26 Score = 19.4 bits (38), Expect = 5.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 3 LWFVLLFIISCLGIS 17 L++ + II C+GIS Sbjct: 241 LFYTVNLIIPCMGIS 255 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 19.4 bits (38), Expect = 5.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 47 RKHYCDCWCKPGLIRDSIAHKCV 69 RK+ C CKP L + + K V Sbjct: 343 RKNNCPLHCKPELGQSQSSPKFV 365 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 19.0 bits (37), Expect = 7.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 3 LWFVLLFIISCLGIS 17 L++ + II C+GIS Sbjct: 237 LFYTVNLIIPCVGIS 251 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 19.0 bits (37), Expect = 7.6 Identities = 7/20 (35%), Positives = 8/20 (40%) Query: 32 CAFETICALRSAHSNRKHYC 51 C E C + NR YC Sbjct: 146 CREEKSCIIDKRQRNRCQYC 165 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 19.0 bits (37), Expect = 7.6 Identities = 7/20 (35%), Positives = 8/20 (40%) Query: 32 CAFETICALRSAHSNRKHYC 51 C E C + NR YC Sbjct: 146 CREEKSCIIDKRQRNRCQYC 165 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.327 0.142 0.516 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,415 Number of Sequences: 429 Number of extensions: 1021 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 80 length of database: 140,377 effective HSP length: 47 effective length of query: 33 effective length of database: 120,214 effective search space: 3967062 effective search space used: 3967062 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.8 bits) S2: 36 (18.6 bits)
- SilkBase 1999-2023 -