BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000452-TA|BGIBMGA000452-PA|IPR000990|Innexin (385 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 40 9e-05 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 27 0.66 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 2.0 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 6.1 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 6.1 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 40.3 bits (90), Expect = 9e-05 Identities = 31/126 (24%), Positives = 51/126 (40%), Gaps = 8/126 (6%) Query: 25 IDNMVFRMHYRITSAILFLCCILVTANNLIGEPIACISDGANPGHVINTFCWI---TYTF 81 I N R+ T + LC L+ + P + +SDG + T + TY Sbjct: 59 IGNRTIRLQVHFTWVLAALCAFLLLVLYISSSPSSLLSDGPRTNSFLRTSAIVYNHTYPL 118 Query: 82 TMPNTTSKT-AAHPGLGDDNDEKRIHSYYQWVPFMLFFQGLLFYIP--HWIWKNWEEGKV 138 T P +S + G+ D D QW + + +G L +IP I +W+EG+ Sbjct: 119 TSPIVSSGIYSFRVGIIADLDTNSALKKNQWGSY--YLKGCLSFIPSKRSITVSWDEGEA 176 Query: 139 RLISEG 144 + + G Sbjct: 177 KALQSG 182 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 27.5 bits (58), Expect = 0.66 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 318 ALVRKTQVGDFLLLHLLGQNMSLRVFGEVLDELSRRLNLGSHAPS 362 A VR+TQ GD LL+ G+ ++RV + + L + N+ + APS Sbjct: 204 AKVRRTQNGDMLLVLKRGKE-AVRVEAGIKNALKDKANVRTLAPS 247 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 2.0 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 288 VYSAAVCLLPSTRETILKRRF---RFGTP 313 V A LLP+TR +LKR R+GTP Sbjct: 1073 VIGGAPALLPTTRTLLLKRPLVSARYGTP 1101 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 24.2 bits (50), Expect = 6.1 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 171 LHMHNTYSFGYFFCEVLNFAN-VVGNIFFLDTFL 203 + +++ FGY F V+NF N++F D F+ Sbjct: 647 MRFYDSLPFGYPFDRVINFNYFYTKNMYFKDVFI 680 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 6.1 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 171 LHMHNTYSFGYFFCEVLNFAN-VVGNIFFLDTFL 203 + +++ FGY F V+NF N++F D F+ Sbjct: 647 MRFYDSLPFGYPFDRVINFNYFYTKNMYFKDVFI 680 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.140 0.432 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 398,103 Number of Sequences: 2123 Number of extensions: 15970 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 36 Number of HSP's gapped (non-prelim): 5 length of query: 385 length of database: 516,269 effective HSP length: 65 effective length of query: 320 effective length of database: 378,274 effective search space: 121047680 effective search space used: 121047680 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -