GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000452-TA|BGIBMGA000452-PA|IPR000990|Innexin
         (385 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y09538-1|CAA70733.1|  452|Homo sapiens LIM-domain protein protein.     31   5.2  

>Y09538-1|CAA70733.1|  452|Homo sapiens LIM-domain protein protein.
          Length = 452

 Score = 31.5 bits (68), Expect = 5.2
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 309 RFGTPNGVEALVRKTQVGDFLLLHLLGQNMSLRVFGEVLDELSRRLNLGSHAPSAPSTLE 368
           R  +P+G E LVR+   G  +L    G++++ +V GE   +  R    G   P+ P+   
Sbjct: 213 RQSSPSGSEQLVRRESCGSSVLTDFEGKDVATKV-GEAWQDRPRAPRGGQGDPAVPTQQP 271

Query: 369 MAPIYPD 375
             P  P+
Sbjct: 272 ADPSTPE 278


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.326    0.140    0.432 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,849,579
Number of Sequences: 224733
Number of extensions: 2247846
Number of successful extensions: 7832
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7832
Number of HSP's gapped (non-prelim): 1
length of query: 385
length of database: 73,234,838
effective HSP length: 91
effective length of query: 294
effective length of database: 52,784,135
effective search space: 15518535690
effective search space used: 15518535690
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 66 (30.7 bits)