BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000449-TA|BGIBMGA000449-PA|undefined (205 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 32 0.011 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.7 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 32.3 bits (70), Expect = 0.011 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 118 PMMGAPPSKQREGAQPDSCAQDTSQPSGEYNAQYNAAGGDYYNYQGKGYSGAQQQNK 174 P A P+ + P+S A D S N +++ G NY G GY QQQ + Sbjct: 77 PSSVASPNSRASNMSPESSASDQSAAYTLQNLNLSSSAGTM-NYPGMGYQQQQQQQQ 132 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 3.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 163 GKGYSGAQQQNKPRPNKTRTSAEA 186 G G +GA++Q + R N RT+ +A Sbjct: 574 GVGATGAEKQQQNRSNHHRTTEQA 597 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.310 0.127 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,376 Number of Sequences: 2123 Number of extensions: 6442 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 205 length of database: 516,269 effective HSP length: 61 effective length of query: 144 effective length of database: 386,766 effective search space: 55694304 effective search space used: 55694304 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -