BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000449-TA|BGIBMGA000449-PA|undefined (205 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 1.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 8.3 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 112 LCGDVKPMMGAPPSKQ-REGAQPDSCAQDT 140 L DV+P G+PP KQ R + +C+ T Sbjct: 267 LNSDVQPGHGSPPVKQHRSSSASTTCSGHT 296 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 8.3 Identities = 10/41 (24%), Positives = 16/41 (39%) Query: 127 QREGAQPDSCAQDTSQPSGEYNAQYNAAGGDYYNYQGKGYS 167 +RE ++ S + N YN + YNY Y+ Sbjct: 72 ERERSREPKIISSLSNKTIHNNNNYNNNNYNNYNYNNNNYN 112 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.310 0.127 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,309 Number of Sequences: 429 Number of extensions: 1937 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 205 length of database: 140,377 effective HSP length: 55 effective length of query: 150 effective length of database: 116,782 effective search space: 17517300 effective search space used: 17517300 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -