BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000448-TA|BGIBMGA000448-PA|undefined (559 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0482 + 8798931-8799024,8799118-8799253,8799435-8799506,879... 32 1.4 06_01_0487 - 3459853-3459917,3460058-3460408,3460991-3461114,346... 31 2.4 01_01_0628 - 4731052-4731601,4731825-4732782,4733143-4733953,473... 30 4.2 03_02_0601 - 9754281-9754340,9754978-9755061,9755384-9755585,975... 30 5.6 03_02_0858 + 11848128-11848287,11848906-11848973,11849281-118494... 29 7.4 06_03_0994 + 26691518-26691772,26692054-26692183,26692276-266923... 29 9.7 >03_02_0482 + 8798931-8799024,8799118-8799253,8799435-8799506, 8799583-8799654,8799798-8799869,8800133-8800204, 8800530-8800627,8800892-8801062,8801141-8801473, 8802494-8802739,8802884-8803017,8803132-8803344 Length = 570 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/41 (34%), Positives = 23/41 (56%) Query: 29 YCVKLIVRTVNVLETIETPCVGLDPDEEPTVDRVCRGLNPD 69 YC + + T++ L ++ CV P+E PT+ RV + L D Sbjct: 517 YCEGVQIETLDALLSLAKQCVSSLPEERPTMHRVVQMLESD 557 >06_01_0487 - 3459853-3459917,3460058-3460408,3460991-3461114, 3461226-3461359,3462277-3462412,3462486-3462834, 3463994-3464000,3464058-3464226 Length = 444 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/55 (32%), Positives = 27/55 (49%) Query: 35 VRTVNVLETIETPCVGLDPDEEPTVDRVCRGLNPDQNLITLFSENYVPVNCRSSL 89 VR V + I C+ D PT+D V + L P Q+L + S +Y P + + L Sbjct: 371 VRGVQKVAQICYHCLSRDTKSRPTMDEVVKHLTPLQDLNDMASASYRPRSSQRDL 425 >01_01_0628 - 4731052-4731601,4731825-4732782,4733143-4733953, 4734038-4734241,4734695-4734802,4735930-4736369, 4736463-4736541 Length = 1049 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 118 QTAGTQFLITNQKFNITYRRCQGMSNTFDGVVE 150 QT Q +IT + ++TY CQG+++ F VE Sbjct: 329 QTRSHQNMITQEGSSLTYNGCQGITSNFLSTVE 361 >03_02_0601 - 9754281-9754340,9754978-9755061,9755384-9755585, 9755663-9755730,9755999-9756094,9756307-9756508, 9756590-9756661,9756786-9756826,9757016-9757089, 9757991-9758026,9758486-9758720 Length = 389 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 437 NLKSYLITFDELDPFSKYRCWVYQRADLNRVLMSQALGPYCDLKQD 482 ++ Y F ++DP + ++ W+ Q+ D N LMS+ + P D+ ++ Sbjct: 157 SIDEYSSYFGDIDPLAPFKKWIVQQPD-NINLMSEKVHPSYDVFEE 201 >03_02_0858 + 11848128-11848287,11848906-11848973,11849281-11849403, 11850796-11851128,11851199-11851321,11851414-11851632 Length = 341 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 47 PCVGLDPDEEPTVDRVC 63 PC+G +PD EP V VC Sbjct: 192 PCIGAEPDHEPPVHVVC 208 >06_03_0994 + 26691518-26691772,26692054-26692183,26692276-26692360, 26692740-26692986 Length = 238 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 446 DELDPFSKYRCWVYQRADLNRVLMSQALGPYCDLKQ---DVTSWNYTE 490 ++L P S +R W+ +R+ +R + + + CD + DV W YTE Sbjct: 57 EDLLPESAHRPWLRRRSTGDRSICTMSSPVQCDAEDARGDVKEWMYTE 104 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.324 0.139 0.447 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,269,029 Number of Sequences: 37544 Number of extensions: 700200 Number of successful extensions: 1119 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1115 Number of HSP's gapped (non-prelim): 6 length of query: 559 length of database: 14,793,348 effective HSP length: 86 effective length of query: 473 effective length of database: 11,564,564 effective search space: 5470038772 effective search space used: 5470038772 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -