GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000448-TA|BGIBMGA000448-PA|undefined
         (559 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    23   6.7  

>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 23.0 bits (47), Expect = 6.7
 Identities = 14/71 (19%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 445 FDELDPFSKYRCWVYQRADLNRVLMSQALGPYCDLKQDVTS-WNYTEGAAVAVEMEEYER 503
           FD+   F K+  W Y    ++   ++Q +G   ++  D+   +   E   + V  E +++
Sbjct: 154 FDQQTCFMKFGSWTYDGIQIDLKHINQNMGDKVEIGIDLREYYPSVEWDILGVPAERHKK 213

Query: 504 ERDQCPMHFDD 514
               C   + D
Sbjct: 214 YYPCCDEPYPD 224


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.139    0.447 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,804
Number of Sequences: 429
Number of extensions: 8494
Number of successful extensions: 19
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 19
Number of HSP's gapped (non-prelim): 1
length of query: 559
length of database: 140,377
effective HSP length: 61
effective length of query: 498
effective length of database: 114,208
effective search space: 56875584
effective search space used: 56875584
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 46 (22.6 bits)