Silkworm BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000443-TA|BGIBMGA000443-PA|undefined
         (56 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-762|AAF46052.1|  643|Drosophila melanogaster CG17758-PA...    28   1.4  

>AE014298-762|AAF46052.1|  643|Drosophila melanogaster CG17758-PA
           protein.
          Length = 643

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 4   YRRKEVETAGLEE---TSVSIEMLQLYEETKYTLLSISSGNNRYLAINGTIPSN 54
           YR K +   GL     T++++ +  L +ETK+ +L+  +  NR L I+  IP +
Sbjct: 174 YRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGH 227


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.309    0.128    0.329 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,523,380
Number of Sequences: 52641
Number of extensions: 70108
Number of successful extensions: 146
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 145
Number of HSP's gapped (non-prelim): 1
length of query: 56
length of database: 24,830,863
effective HSP length: 37
effective length of query: 19
effective length of database: 22,883,146
effective search space: 434779774
effective search space used: 434779774
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)
S2: 53 (25.4 bits)