GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000443-TA|BGIBMGA000443-PA|undefined
         (56 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.           20   2.7  

>AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.
          Length = 126

 Score = 19.8 bits (39), Expect = 2.7
 Identities = 9/30 (30%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 22 EMLQLYEETKY-TLLSISSGNNRYLAINGT 50
          +++Q +EE    T   ++   NRY+ ++GT
Sbjct: 45 KLVQGFEEQDILTSSGVTLAGNRYIYLSGT 74


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.309    0.128    0.329 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,358
Number of Sequences: 429
Number of extensions: 586
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 56
length of database: 140,377
effective HSP length: 36
effective length of query: 20
effective length of database: 124,933
effective search space:  2498660
effective search space used:  2498660
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.6 bits)
S2: 35 (18.2 bits)