BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000442-TA|BGIBMGA000442-PA|IPR000863|Sulfotransferase (825 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0695 + 18790491-18790565,18791299-18791427,18792981-18794189 31 4.9 >04_03_0695 + 18790491-18790565,18791299-18791427,18792981-18794189 Length = 470 Score = 30.7 bits (66), Expect = 4.9 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 6/110 (5%) Query: 670 SMLRSEPAVVMNTLQKFLKISPHIDYNKLLKIAITERGELYRLGRFEKMGNVIIERLYGL 729 S LRSE + + ++K +K L K + E E ++ + EK+ N + + L Sbjct: 123 SALRSEIDLARSHVRKLIKEQKSEGIESLKKQLVQEM-ESWKSKQKEKVANALQYIVSEL 181 Query: 730 EVANVGRRSLVRINNVRTRFAFNDDADLKAPKELVGGEKTKCLGKSKGRV 779 + RR RIN N +A L+A + + E+ KSKGRV Sbjct: 182 DSEKKSRRRAERINKKLGMALANTEASLQAATKELERER-----KSKGRV 226 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.137 0.432 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,978,531 Number of Sequences: 37544 Number of extensions: 1163167 Number of successful extensions: 2217 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2217 Number of HSP's gapped (non-prelim): 1 length of query: 825 length of database: 14,793,348 effective HSP length: 88 effective length of query: 737 effective length of database: 11,489,476 effective search space: 8467743812 effective search space used: 8467743812 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 64 (29.9 bits)
- SilkBase 1999-2023 -