BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000442-TA|BGIBMGA000442-PA|IPR000863|Sulfotransferase (825 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 3.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 3.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 8.5 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Query: 143 HDYETDGERMPLATVIQDHGRLDGVQRVLFGSGLQFWLH 181 HD++ VIQ H + G R G G + W H Sbjct: 47 HDFDNSDFFQSEHAVIQTHPSIGGGPRFSSGVGRKAWKH 85 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Query: 143 HDYETDGERMPLATVIQDHGRLDGVQRVLFGSGLQFWLH 181 HD++ VIQ H + G R G G + W H Sbjct: 47 HDFDNSDFFQSEHAVIQTHPSIGGGPRFSSGVGRKAWKH 85 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 305 QFALEHGIPTNSCYSVSPHHSGVYPVH 331 Q AL + + + PH S V P+H Sbjct: 1401 QIALTSTTTNSLTFKLKPHESDVEPIH 1427 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.432 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,875 Number of Sequences: 317 Number of extensions: 9781 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 3 length of query: 825 length of database: 114,650 effective HSP length: 62 effective length of query: 763 effective length of database: 94,996 effective search space: 72481948 effective search space used: 72481948 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -