BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000441-TA|BGIBMGA000441-PA|undefined (153 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 2.0 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 2.0 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 2.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Query: 47 GVMLLSVLTILFYSYYVTIPLTSLVWRDRIPRPL 80 GV L VL +Y YYV S V I P+ Sbjct: 260 GVSLFDVLFQAYYLYYVATGKASFVTVPMIVCPI 293 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 2.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Query: 47 GVMLLSVLTILFYSYYVTIPLTSLVWRDRIPRPL 80 GV L VL +Y YYV S V I P+ Sbjct: 260 GVSLFDVLFQAYYLYYVATGKASFVTVPMIVCPI 293 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.140 0.441 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,385 Number of Sequences: 317 Number of extensions: 914 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 153 length of database: 114,650 effective HSP length: 52 effective length of query: 101 effective length of database: 98,166 effective search space: 9914766 effective search space used: 9914766 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -