GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000441-TA|BGIBMGA000441-PA|undefined
         (153 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domai...    24   1.9  

>DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 285

 Score = 24.2 bits (50), Expect = 1.9
 Identities = 12/41 (29%), Positives = 17/41 (41%)

Query: 7   GARAPLLECGSGEYSHNHKTLAPRCCFWLASHVNVRKCVAG 47
           GA+ P+  CG  E      T     C  +++ V  R C  G
Sbjct: 202 GAKCPITTCGRNEALQACGTCNQITCSGISTEVCRRSCYCG 242


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.326    0.140    0.441 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,314
Number of Sequences: 2123
Number of extensions: 4593
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 153
length of database: 516,269
effective HSP length: 59
effective length of query: 94
effective length of database: 391,012
effective search space: 36755128
effective search space used: 36755128
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 44 (21.8 bits)