GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000439-TA|BGIBMGA000439-PA|IPR001107|Band 7 protein,
IPR001972|Stomatin
         (257 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    23   3.0  

>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
          protein 17 protein.
          Length = 124

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 10/34 (29%), Positives = 16/34 (47%)

Query: 38 FFVLPCIDTYRKVDLRTVSFDVPPQEVLTRDSVT 71
          F V  C+  Y   +  TV  ++   E+L  D +T
Sbjct: 6  FVVFACVQAYVYAEEYTVPQNIDIDEILKNDRLT 39


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.323    0.135    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,837
Number of Sequences: 317
Number of extensions: 1152
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 257
length of database: 114,650
effective HSP length: 55
effective length of query: 202
effective length of database: 97,215
effective search space: 19637430
effective search space used: 19637430
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 42 (21.0 bits)