BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000437-TA|BGIBMGA000437-PA|IPR000618|Insect cuticle protein (256 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 70 6e-14 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 70 6e-14 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 70 6e-14 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 62 1e-11 AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. 24 4.9 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 24 4.9 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 24 4.9 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 24 4.9 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 4.9 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 87 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 236 EV 237 V Sbjct: 147 VV 148 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 87 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNA 146 Query: 236 EV 237 V Sbjct: 147 VV 148 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 87 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 236 EV 237 V Sbjct: 147 VV 148 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 111 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 170 Query: 236 EV 237 V Sbjct: 171 VV 172 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 87 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 236 EV 237 V Sbjct: 147 VV 148 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 87 HAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 236 EV 237 V Sbjct: 147 VV 148 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 70.1 bits (164), Expect = 6e-14 Identities = 33/62 (53%), Positives = 39/62 (62%) Query: 176 YAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNA 235 +A Y F Y + D HTGD K QHE R GD V G+YSL ++DG R V Y AD +GFNA Sbjct: 79 HAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 236 EV 237 V Sbjct: 139 VV 140 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 62.5 bits (145), Expect = 1e-11 Identities = 29/46 (63%), Positives = 35/46 (76%) Query: 192 TGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKKSGFNAEV 237 TGD+K Q E RDGDVV+G YS+ + DG+ RTV YTAD +GFNA V Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVV 79 >AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 208 KGEYSLHEADGSIRTVKYTADKKSGFNAEVINS 240 + E ++ E DG+++ YT +GF +V S Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 208 KGEYSLHEADGSIRTVKYTADKKSGFNAEVINS 240 + E ++ E DG+++ YT +GF +V S Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 208 KGEYSLHEADGSIRTVKYTADKKSGFNAEVINS 240 + E ++ E DG+++ YT +GF +V S Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 208 KGEYSLHEADGSIRTVKYTADKKSGFNAEVINS 240 + E ++ E DG+++ YT +GF +V S Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEES 255 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 208 KGEYSLHEADGSIRTVKYTADKKSGFNAEVINS 240 + E ++ E DG+++ YT +GF +V S Sbjct: 1362 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEES 1394 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,901 Number of Sequences: 2123 Number of extensions: 5223 Number of successful extensions: 23 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 19 length of query: 256 length of database: 516,269 effective HSP length: 63 effective length of query: 193 effective length of database: 382,520 effective search space: 73826360 effective search space used: 73826360 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -