GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000437-TA|BGIBMGA000437-PA|IPR000618|Insect cuticle
protein
         (256 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g23680.1 68417.m03409 major latex protein-related / MLP-relat...    28   5.3  

>At4g23680.1 68417.m03409 major latex protein-related / MLP-related
           low similarity to major latex protein {Papaver
           somniferum}[GI:294060] ; contains Pfam profile PF00407:
           Pathogenesis-related protein Bet v I family
          Length = 151

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query: 180 KYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKYTADKK 230
           KY   +K E+ H   +   H I++  V +GE   H++ GSIR+  YT D K
Sbjct: 19  KYYKRWKNEN-HVFPDAIGHHIQNVTVHEGE---HDSHGSIRSWNYTWDGK 65


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,801,822
Number of Sequences: 28952
Number of extensions: 121977
Number of successful extensions: 254
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 254
Number of HSP's gapped (non-prelim): 1
length of query: 256
length of database: 12,070,560
effective HSP length: 80
effective length of query: 176
effective length of database: 9,754,400
effective search space: 1716774400
effective search space used: 1716774400
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 58 (27.5 bits)