BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000435-TA|BGIBMGA000435-PA|IPR000618|Insect cuticle protein (109 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 25 0.13 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 24 0.40 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 2.8 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 25.4 bits (53), Expect = 0.13 Identities = 13/44 (29%), Positives = 21/44 (47%) Query: 54 YKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGD 97 Y V + ++ + + DG +V Y + DGS+R V Y D Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.8 bits (49), Expect = 0.40 Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 84 QPDGSIRHVDYHGDHHSGLVTNI 106 Q DG++RH+D + D +G + + Sbjct: 64 QADGNVRHLDEYLDVDAGTIAKL 86 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.0 bits (42), Expect = 2.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 84 QPDGSIRHVDY 94 QPD +I H DY Sbjct: 137 QPDNAIEHSDY 147 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.134 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,320 Number of Sequences: 317 Number of extensions: 745 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 109 length of database: 114,650 effective HSP length: 49 effective length of query: 60 effective length of database: 99,117 effective search space: 5947020 effective search space used: 5947020 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -