BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000435-TA|BGIBMGA000435-PA|IPR000618|Insect cuticle protein (109 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.20 SB_34999| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.9 SB_54180| Best HMM Match : Mfp-3 (HMM E-Value=1.9) 28 1.9 SB_5797| Best HMM Match : PH (HMM E-Value=3.7e-37) 26 5.8 SB_4239| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) 26 7.7 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 31.1 bits (67), Expect = 0.20 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Query: 51 DFEYKVSDPHTGDHKSQHESRDGDVVKGY--YSLHQPDGSIRHVDYHGD 97 D + + GD +H+ DGD V + Y+ D +RH DY GD Sbjct: 1863 DVRHDEYNDEDGDSDVRHDDYDGDSVVRHDDYNDDNGDSDVRHDDYDGD 1911 Score = 26.6 bits (56), Expect = 4.4 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 5/52 (9%) Query: 51 DFEYKVSDPHTGDHKSQHESR-----DGDVVKGYYSLHQPDGSIRHVDYHGD 97 D + ++ GD +H+ D DV Y+ D +RH DY GD Sbjct: 1835 DVRHDDNNDDDGDSDVRHDDNNDDDGDSDVRHDEYNDEDGDSDVRHDDYDGD 1886 >SB_34999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 27.9 bits (59), Expect = 1.9 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query: 62 GDHKSQHESRDG--DVVKGYYSLHQPDGSIR 90 GDH+S HE + G D+ +G ++ +P+ IR Sbjct: 106 GDHQSHHEEKRGLQDLAQGLHACARPEKLIR 136 >SB_54180| Best HMM Match : Mfp-3 (HMM E-Value=1.9) Length = 125 Score = 27.9 bits (59), Expect = 1.9 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Query: 78 GYYSLHQPDGSIRHVDYHG-DHHSG 101 GY+ H D I H DY G DH+ G Sbjct: 69 GYHGYHDHDVHIHHHDYGGHDHYDG 93 >SB_5797| Best HMM Match : PH (HMM E-Value=3.7e-37) Length = 1481 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 61 TGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGD 97 + H S H+ D D + G+ + Q + R +DY G+ Sbjct: 123 SSSHMSAHKM-DDDYLSGFAADEQEESDARELDYEGE 158 >SB_4239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 25.8 bits (54), Expect = 7.7 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 10/55 (18%) Query: 53 EYKVSDPHTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSGLVTNIV 107 EY + + GD + H+S GYYS HQ D H +H SG +++++ Sbjct: 33 EYSID--YVGDQSAHHDS-------GYYSSHQNDYHHGHKRHH-RRSSGWLSSLI 77 >SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) Length = 1716 Score = 25.8 bits (54), Expect = 7.7 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 60 HTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHS 100 +TG+H QH ++ G + + P I H HGDH++ Sbjct: 379 YTGNHDDQHSNQCRR--PGNHG-NLPSNQIGHTGNHGDHYT 416 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,088,574 Number of Sequences: 59808 Number of extensions: 106647 Number of successful extensions: 270 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 267 Number of HSP's gapped (non-prelim): 7 length of query: 109 length of database: 16,821,457 effective HSP length: 72 effective length of query: 37 effective length of database: 12,515,281 effective search space: 463065397 effective search space used: 463065397 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -