BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000435-TA|BGIBMGA000435-PA|IPR000618|Insect cuticle protein (109 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97192-1|AAB52434.2| 986|Caenorhabditis elegans Hypothetical pr... 26 6.5 AL132948-1|CAC51077.1| 735|Caenorhabditis elegans Hypothetical ... 26 6.5 Z92970-2|CAB07481.2| 1461|Caenorhabditis elegans Hypothetical pr... 25 8.6 >U97192-1|AAB52434.2| 986|Caenorhabditis elegans Hypothetical protein C01F4.2a protein. Length = 986 Score = 25.8 bits (54), Expect = 6.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 68 HESRDGDVVKGYYSLHQPDGSIRHVDYHGDH-HSGLVTNIVR 108 HES G ++ + + + D S RH HGDH H G + + R Sbjct: 753 HESHPGVLLSPFPATLEEDSSPRH-HRHGDHSHIGRQSPLAR 793 >AL132948-1|CAC51077.1| 735|Caenorhabditis elegans Hypothetical protein Y39B6A.1 protein. Length = 735 Score = 25.8 bits (54), Expect = 6.5 Identities = 13/42 (30%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Query: 60 HTGDHKSQHESRDGDVVKGYYSLHQPDGSIRHVDYHGDHHSG 101 H H HE GD G + +H H H HH G Sbjct: 632 HHAPHHEHHEHH-GDHHHGSHGVHHGHHGTHHSLAHHGHHGG 672 >Z92970-2|CAB07481.2| 1461|Caenorhabditis elegans Hypothetical protein H06O01.2 protein. Length = 1461 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Query: 63 DHKSQHESRDGDVVKGYYSLHQPDGSIR------HVDYHGDHH 99 DHK + +D + +G + +G+ + H D+H DHH Sbjct: 1407 DHKERDREKDRERNRGERRMDHGEGTSKDHHREHHKDHHKDHH 1449 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.318 0.134 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,228,891 Number of Sequences: 27539 Number of extensions: 72018 Number of successful extensions: 155 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 146 Number of HSP's gapped (non-prelim): 11 length of query: 109 length of database: 12,573,161 effective HSP length: 72 effective length of query: 37 effective length of database: 10,590,353 effective search space: 391843061 effective search space used: 391843061 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -