BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000434-TA|BGIBMGA000434-PA|IPR000618|Insect cuticle protein (114 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 0.57 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 23 0.75 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 3.0 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 20 5.3 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 20 7.0 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 20 7.0 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.4 bits (48), Expect = 0.57 Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 84 QPDGSIRHVDYHGDHHSGLVS 104 Q DG++RH+D + D +G ++ Sbjct: 64 QADGNVRHLDEYLDVDAGTIA 84 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 23.0 bits (47), Expect = 0.75 Identities = 13/44 (29%), Positives = 20/44 (45%) Query: 54 YKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGD 97 Y V + ++ + + DG V Y + DGS+R V Y D Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.0 bits (42), Expect = 3.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 84 QPDGSIRHVDY 94 QPD +I H DY Sbjct: 137 QPDNAIEHSDY 147 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 20.2 bits (40), Expect = 5.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 65 KSQHESRDGDD 75 K +HES D DD Sbjct: 281 KEEHESMDDDD 291 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 19.8 bits (39), Expect = 7.0 Identities = 8/28 (28%), Positives = 14/28 (50%) Query: 73 GDDVKGYYSLHQPDGSIRHVDYHGDHHS 100 G+D+ Y GS+ H+ + HH+ Sbjct: 69 GEDIVTYSGHKLKAGSMVHLHIYDMHHN 96 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 19.8 bits (39), Expect = 7.0 Identities = 10/35 (28%), Positives = 15/35 (42%) Query: 72 DGDDVKGYYSLHQPDGSIRHVDYHGDHHSGLVSCN 106 D D++ SLH P + +Y D S + N Sbjct: 88 DRMDIRDRRSLHGPQQQMDGQEYRPDSPSSMHMAN 122 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,346 Number of Sequences: 317 Number of extensions: 949 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 114 length of database: 114,650 effective HSP length: 49 effective length of query: 65 effective length of database: 99,117 effective search space: 6442605 effective search space used: 6442605 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.4 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -