BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000434-TA|BGIBMGA000434-PA|IPR000618|Insect cuticle protein (114 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 75 5e-16 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 75 5e-16 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 74 1e-15 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 57 2e-10 AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 prote... 22 4.7 AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 prote... 22 4.7 AJ000035-1|CAA03871.1| 156|Anopheles gambiae D7r3 protein protein. 22 4.7 AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical prote... 21 8.2 AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosens... 21 8.2 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 75.4 bits (177), Expect = 5e-16 Identities = 32/52 (61%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD KSQHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 74.1 bits (174), Expect = 1e-15 Identities = 31/52 (59%), Positives = 37/52 (71%) Query: 50 FDFEYKVSDPHTGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 ++F Y V D HTGD K+QHE+R GD+V G YSL DG R VDYH DHH+G Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 56.8 bits (131), Expect = 2e-10 Identities = 26/41 (63%), Positives = 30/41 (73%) Query: 61 TGDHKSQHESRDGDDVKGYYSLHQPDGSIRHVDYHGDHHSG 101 TGD KSQ ESRDGD V+G YS+ PDG+ R VDY D H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 87 GSIRHVDYHGDHHSGLVSCN 106 G ++ VD GDH + CN Sbjct: 83 GVLKMVDPDGDHAGSMKKCN 102 >AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 87 GSIRHVDYHGDHHSGLVSCN 106 G ++ VD GDH + CN Sbjct: 83 GVLKMVDPDGDHAGSMKKCN 102 >AJ000035-1|CAA03871.1| 156|Anopheles gambiae D7r3 protein protein. Length = 156 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 87 GSIRHVDYHGDHHSGLVSCN 106 G ++ VD GDH + CN Sbjct: 83 GVLKMVDPDGDHAGSMKKCN 102 >AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical protein protein. Length = 168 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 57 SDPHTGDHKSQHESRDGDDVKG 78 +D T H ++H S+D D +G Sbjct: 142 ADTETEAHATEHNSQDHDHREG 163 >AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosensory protein CSP3 protein. Length = 168 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 57 SDPHTGDHKSQHESRDGDDVKG 78 +D T H ++H S+D D +G Sbjct: 142 ADTETEAHATEHNSQDHDHREG 163 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.135 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,920 Number of Sequences: 2123 Number of extensions: 3948 Number of successful extensions: 20 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 19 length of query: 114 length of database: 516,269 effective HSP length: 56 effective length of query: 58 effective length of database: 397,381 effective search space: 23048098 effective search space used: 23048098 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -