BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000432-TA|BGIBMGA000432-PA|IPR000618|Insect cuticle protein (59 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 72 2e-15 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 72 2e-15 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 71 4e-15 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 71 5e-15 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 52 2e-09 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 20 7.6 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 20 10.0 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 20 10.0 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 20 10.0 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 71.7 bits (168), Expect = 2e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 70.9 bits (166), Expect = 4e-15 Identities = 30/52 (57%), Positives = 34/52 (65%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG R + YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 70.5 bits (165), Expect = 5e-15 Identities = 29/52 (55%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 YEF Y V D HT D K+QHETR GD V G Y+L + DG +R + YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 52.0 bits (119), Expect = 2e-09 Identities = 21/41 (51%), Positives = 30/41 (73%) Query: 19 TKDHKSQHETRDGDAVKGYYALHEPDGSERYIHYHGDKHSG 59 T D KSQ E+RDGD V+G Y++ +PDG++R + Y D H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/20 (35%), Positives = 11/20 (55%) Query: 37 YYALHEPDGSERYIHYHGDK 56 YYA +P GS +++ K Sbjct: 1144 YYAQSQPQGSPLRLYFFASK 1163 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 19.8 bits (39), Expect = 10.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 39 ALHEPDGSERYIHYH 53 AL PDG R +YH Sbjct: 233 ALGYPDGFARVSYYH 247 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 19.8 bits (39), Expect = 10.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 39 ALHEPDGSERYIHYH 53 AL PDG R +YH Sbjct: 233 ALGYPDGFARVSYYH 247 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 19.8 bits (39), Expect = 10.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Query: 13 KVEDHHTKDHKSQHE 27 KV D K HK QHE Sbjct: 201 KVIDALLKRHKHQHE 215 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.134 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,793 Number of Sequences: 2123 Number of extensions: 2698 Number of successful extensions: 18 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of query: 59 length of database: 516,269 effective HSP length: 38 effective length of query: 21 effective length of database: 435,595 effective search space: 9147495 effective search space used: 9147495 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.6 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -