BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000431-TA|BGIBMGA000431-PA|IPR000618|Insect cuticle protein (59 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 71 3e-15 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 71 3e-15 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 71 5e-15 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 70 7e-15 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 52 2e-09 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 0.81 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 0.81 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 0.81 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 21 4.3 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 20 7.6 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 20 7.6 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 20 7.6 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 20 10.0 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 20 10.0 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 71.3 bits (167), Expect = 3e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 70.5 bits (165), Expect = 5e-15 Identities = 31/52 (59%), Positives = 34/52 (65%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D KSQHETR GD V G Y+L + DG R V YH D H+G Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 70.1 bits (164), Expect = 7e-15 Identities = 30/52 (57%), Positives = 35/52 (67%) Query: 8 YEFEYKVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 YEF Y V D HT D K+QHETR GD V G Y+L + DG +R V YH D H+G Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 52.4 bits (120), Expect = 2e-09 Identities = 22/41 (53%), Positives = 30/41 (73%) Query: 19 TKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 T D KSQ E+RDGD V+G Y++ +PDG++R V Y D H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 0.81 Identities = 10/43 (23%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Query: 17 HHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 H + H S H+ + H+ + H H+H +H G Sbjct: 254 HQQQQHPSSHQQQSQQHPSSQ---HQQPTHQTHHHHHHHQHGG 293 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 0.81 Identities = 10/43 (23%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Query: 17 HHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 H + H S H+ + H+ + H H+H +H G Sbjct: 254 HQQQQHPSSHQQQSQQHPSSQ---HQQPTHQTHHHHHHHQHGG 293 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 0.81 Identities = 10/43 (23%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Query: 17 HHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 H + H S H+ + H+ + H H+H +H G Sbjct: 206 HQQQQHPSSHQQQSQQHPSSQ---HQQPTHQTHHHHHHHQHGG 245 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 21.0 bits (42), Expect = 4.3 Identities = 12/57 (21%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 1 MLKTHPKYEFEY-KVEDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDK 56 ++K H K F+ + T + ++ + YYA +P GS +++ K Sbjct: 1107 LVKAHDKDTFKIVSIATGETLFDTNTTKSEELQLTVPYYAQSQPQGSPLRLYFFASK 1163 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 37 YYALHEPDGSERHVHYHGDKH 57 Y + EP S +H H+ H Sbjct: 15 YTTVSEPSASTKHRHHSRHHH 35 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 37 YYALHEPDGSERHVHYHGDKH 57 Y + EP S +H H+ H Sbjct: 15 YTTVSEPSASTKHRHHSRHHH 35 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 37 YYALHEPDGSERHVHYHGDKH 57 Y + EP S +H H+ H Sbjct: 15 YTTVSEPSASTKHRHHSRHHH 35 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 19.8 bits (39), Expect = 10.0 Identities = 5/21 (23%), Positives = 11/21 (52%) Query: 37 YYALHEPDGSERHVHYHGDKH 57 ++ +P ++H H+H H Sbjct: 641 HHQSQQPQQQQQHQHHHHHHH 661 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 19.8 bits (39), Expect = 10.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Query: 13 KVEDHHTKDHKSQHE 27 KV D K HK QHE Sbjct: 201 KVIDALLKRHKHQHE 215 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.133 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,341 Number of Sequences: 2123 Number of extensions: 2870 Number of successful extensions: 23 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of query: 59 length of database: 516,269 effective HSP length: 38 effective length of query: 21 effective length of database: 435,595 effective search space: 9147495 effective search space used: 9147495 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.5 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -