BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000431-TA|BGIBMGA000431-PA|IPR000618|Insect cuticle protein (59 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15D4.12c |mug98||sequence orphan|Schizosaccharomyces pombe|c... 27 0.39 SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces ... 24 2.1 SPAC688.06c |slx4||structure-specific endonuclease subunit |Schi... 24 2.8 SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomy... 24 2.8 SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 23 4.8 SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces po... 23 4.8 SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce... 23 6.4 SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po... 22 8.4 SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe... 22 8.4 SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual 22 8.4 >SPBC15D4.12c |mug98||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 113 Score = 26.6 bits (56), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 6 PKYEFEYKVEDHHTKDHKSQHETRDGD-AVKGYYALHEPDGSERHVHY 52 P Y E K+ ++ ++ + +G YY H P+G+ HV+Y Sbjct: 66 PLYNVEAKINHSYSAFYRPFTKRENGLWYANPYYMQHGPNGNYHHVYY 113 >SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 24.2 bits (50), Expect = 2.1 Identities = 12/45 (26%), Positives = 19/45 (42%) Query: 15 EDHHTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHSG 59 + + T + S+ + D V G + GS H HG +H G Sbjct: 176 QSYPTDTYGSRQKATPSDTVGGGAYDYSSSGSHTHGGSHGTEHRG 220 >SPAC688.06c |slx4||structure-specific endonuclease subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 419 Score = 23.8 bits (49), Expect = 2.8 Identities = 10/39 (25%), Positives = 20/39 (51%) Query: 18 HTKDHKSQHETRDGDAVKGYYALHEPDGSERHVHYHGDK 56 +T +H + H R+ + G+Y +P E+ + G+K Sbjct: 138 NTFEHSAYHSNREEISSSGFYYHRKPQLFEKSLEKLGNK 176 >SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomyces pombe|chr 3|||Manual Length = 286 Score = 23.8 bits (49), Expect = 2.8 Identities = 7/29 (24%), Positives = 15/29 (51%) Query: 5 HPKYEFEYKVEDHHTKDHKSQHETRDGDA 33 H +++++ DHH DH S + + + Sbjct: 17 HHTHDYDHHNHDHHGHDHHSHDSSSNSSS 45 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 23.0 bits (47), Expect = 4.8 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 23 KSQHETRDGDAVKGYYALHEPDGSERHVHYHGDKHS 58 KS R D ++G LH P+ + +++ HS Sbjct: 245 KSHWRERIWDLIQGMVTLHIPEQAAWTIYFEWQDHS 280 >SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 793 Score = 23.0 bits (47), Expect = 4.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 30 DGDAVKGYYALHEPDGSERHVHY 52 DGD Y+ D +ERH++Y Sbjct: 429 DGDFGNVYFLATLKDSTERHLYY 451 >SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces pombe|chr 3|||Manual Length = 1008 Score = 22.6 bits (46), Expect = 6.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 32 DAVKGYYALHEPDGSERHVHYHGDK 56 DA+K +A + P ERH +H + Sbjct: 319 DAMKTEHASNAPLTDERHFQFHSSE 343 >SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces pombe|chr 2|||Manual Length = 1014 Score = 22.2 bits (45), Expect = 8.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 12 YKVEDHHTKDHKSQHETR 29 +KVED+ K+HK + R Sbjct: 410 HKVEDYLRKNHKGSKDAR 427 >SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 22.2 bits (45), Expect = 8.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Query: 23 KSQHETRDGDAVKGYYALHEPDGSE 47 K+ ++ GD++ G Y++ E G+E Sbjct: 395 KAIRDSMVGDSIHGLYSILETSGAE 419 >SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 22.2 bits (45), Expect = 8.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 18 HTKDHKSQHETRDGDAVKGY 37 H H Q + DGD V GY Sbjct: 210 HYSGHGGQTKDLDGDEVDGY 229 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.312 0.133 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 333,578 Number of Sequences: 5004 Number of extensions: 10805 Number of successful extensions: 18 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 10 length of query: 59 length of database: 2,362,478 effective HSP length: 40 effective length of query: 19 effective length of database: 2,162,318 effective search space: 41084042 effective search space used: 41084042 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -