Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000425-TA|BGIBMGA000425-
PA|IPR002123|Phospholipid/glycerol acyltransferase
         (310 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855505-1|ABH88192.1|  119|Tribolium castaneum chemosensory pro...    23   2.9  

>DQ855505-1|ABH88192.1|  119|Tribolium castaneum chemosensory
           protein 19 protein.
          Length = 119

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%)

Query: 78  EKDKEIIKKQISELCDYPDPVWLLLT----PEGTRYTKTK 113
           EK KE+ KK I  L      +W  LT    P+G  + K K
Sbjct: 75  EKQKEMTKKVIHFLSHNKQQMWKELTAKYDPDGIYFEKYK 114


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.138    0.429 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,349
Number of Sequences: 317
Number of extensions: 3335
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 310
length of database: 114,650
effective HSP length: 57
effective length of query: 253
effective length of database: 96,581
effective search space: 24434993
effective search space used: 24434993
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)