Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000425-TA|BGIBMGA000425-
PA|IPR002123|Phospholipid/glycerol acyltransferase
         (310 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF487533-1|AAL93294.1|  531|Anopheles gambiae cytochrome P450 CY...    23   8.3  

>AF487533-1|AAL93294.1|  531|Anopheles gambiae cytochrome P450
          CYP9K1 protein.
          Length = 531

 Score = 23.4 bits (48), Expect = 8.3
 Identities = 8/33 (24%), Positives = 20/33 (60%)

Query: 43 VLGNCKAYAKKSIQYLPPIGWMWKFSEFVFLER 75
          V+ + + +A + + YLPP+  +   ++F+  +R
Sbjct: 29 VVRSTRFFADRGVPYLPPVPLLGNGADFITRKR 61


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.138    0.429 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 314,179
Number of Sequences: 2123
Number of extensions: 12371
Number of successful extensions: 69
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 68
Number of HSP's gapped (non-prelim): 1
length of query: 310
length of database: 516,269
effective HSP length: 64
effective length of query: 246
effective length of database: 380,397
effective search space: 93577662
effective search space used: 93577662
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 48 (23.4 bits)