BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000424-TA|BGIBMGA000424-PA|IPR002076|GNS1/SUR4 membrane protein (185 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 25 0.50 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 22 3.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 8.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.1 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 24.6 bits (51), Expect = 0.50 Identities = 10/16 (62%), Positives = 11/16 (68%) Query: 38 TPGGHSTFFGLLNTFV 53 TPGGHS F+G L V Sbjct: 194 TPGGHSGFWGQLGAAV 209 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.8 bits (44), Expect = 3.5 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 128 YDQSYSKPKVRAKSPQPELETTEIKE-LTYQ 157 + S + K SP P+LE E KE LT Q Sbjct: 217 HPDSPNSKKSATPSPPPQLEVNERKENLTCQ 247 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/18 (33%), Positives = 11/18 (61%) Query: 79 YLTTLQMVQFVGIMVHAF 96 + L ++QF +M+H F Sbjct: 1290 FFALLMVIQFFAMMIHRF 1307 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/18 (33%), Positives = 11/18 (61%) Query: 79 YLTTLQMVQFVGIMVHAF 96 + L ++QF +M+H F Sbjct: 1290 FFALLMVIQFFAMMIHRF 1307 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 20.6 bits (41), Expect = 8.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 76 WKKYLTTLQMVQFV 89 WK Y+T + +V FV Sbjct: 203 WKVYITLVALVLFV 216 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.6 bits (41), Expect = 8.1 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 59 TYYMLAAMGPHMRKYLWWKKYLT 81 TYY LA RK L+W T Sbjct: 91 TYYNLADPARDSRKGLFWSPAAT 113 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.330 0.141 0.469 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,668 Number of Sequences: 317 Number of extensions: 2352 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 6 length of query: 185 length of database: 114,650 effective HSP length: 53 effective length of query: 132 effective length of database: 97,849 effective search space: 12916068 effective search space used: 12916068 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -