BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000423-TA|BGIBMGA000423-PA|IPR000771|Ketose-bisphosphate aldolase, class-II (65 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 35 8e-05 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 0.26 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 19 4.2 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 19 5.6 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 18 9.8 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 18 9.8 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 18 9.8 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 34.7 bits (76), Expect = 8e-05 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 6/46 (13%) Query: 16 AREGDIRGDNSNGGNE----VREGEIGRNGELVEF--EKVILEEII 55 AR+G ++ DNSN G E V E EIG+N + VE EK++ + ++ Sbjct: 230 ARKGKLKHDNSNEGGEGFATVEESEIGKNTKQVELTDEKIVAQALL 275 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.0 bits (47), Expect = 0.26 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Query: 15 GAREGDIRGDNSNGGNEVREGE--IGRNGELVE--FEKVILEEIILMECNEVEM 64 G R G GD +GG E ++ E I E VE F I + M+ +E+E+ Sbjct: 93 GGRGGGRDGDRGDGGGEEKKREFYIPPEVENVEDLFTSGITTGVNFMKLDEIEV 146 Score = 19.0 bits (37), Expect = 4.2 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 28 GGNEVREGEIGRNGELVEFEKVILEEI 54 GG ++R + GR + V EE+ Sbjct: 553 GGRDIRGDDFGRGQDFSNAAAVQEEEV 579 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 19.0 bits (37), Expect = 4.2 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 32 VREGEIGRNGELVEFEKV-ILEEII 55 V G+ G+N L EFE + +L II Sbjct: 323 VVRGDNGQNIPLTEFEGIDVLGNII 347 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 18.6 bits (36), Expect = 5.6 Identities = 7/19 (36%), Positives = 10/19 (52%) Query: 24 DNSNGGNEVREGEIGRNGE 42 DN N + +GE RN + Sbjct: 395 DNRNNTSSRAQGETSRNSK 413 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 17.8 bits (34), Expect = 9.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 44 VEFEKVILEEIILME 58 V EK+ILE I M+ Sbjct: 67 VGIEKIILESAIPMK 81 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 17.8 bits (34), Expect = 9.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 44 VEFEKVILEEIILME 58 V EK+ILE I M+ Sbjct: 67 VGIEKIILESAIPMK 81 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 17.8 bits (34), Expect = 9.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 44 VEFEKVILEEIILME 58 V EK+ILE I M+ Sbjct: 67 VGIEKIILESAIPMK 81 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.138 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,868 Number of Sequences: 317 Number of extensions: 434 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 65 length of database: 114,650 effective HSP length: 43 effective length of query: 22 effective length of database: 101,019 effective search space: 2222418 effective search space used: 2222418 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.1 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -