BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000417-TA|BGIBMGA000417-PA|undefined (790 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62110.1 68418.m07796 hypothetical protein 36 0.14 At3g19210.1 68416.m02438 DNA repair protein RAD54, putative simi... 35 0.24 At1g22870.1 68414.m02855 protein kinase family protein contains ... 34 0.32 At4g17695.1 68417.m02643 myb family transcription factor (KAN3) ... 34 0.42 At1g77500.1 68414.m09025 expressed protein contains Pfam domains... 33 0.56 At1g20720.1 68414.m02596 helicase-related similar to BRCA1-bindi... 33 0.74 At5g36740.1 68418.m04402 PHD finger family protein 33 0.97 At5g36670.1 68418.m04388 PHD finger family protein 33 0.97 At4g09960.2 68417.m01630 MADS-box protein (AGL11) 33 0.97 At2g33350.1 68415.m04088 hypothetical protein 32 1.7 At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein ... 31 2.2 At4g34430.4 68417.m04893 DNA-binding family protein contains Pfa... 31 3.0 At4g34430.3 68417.m04892 DNA-binding family protein contains Pfa... 31 3.0 At4g34430.2 68417.m04891 DNA-binding family protein contains Pfa... 31 3.0 At4g34430.1 68417.m04890 DNA-binding family protein contains Pfa... 31 3.0 At5g08520.1 68418.m01011 myb family transcription factor contain... 31 3.9 At5g07340.1 68418.m00838 calnexin, putative identical to calnexi... 30 6.9 At4g14620.1 68417.m02250 expressed protein contains Pfam profile... 30 6.9 At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 30 6.9 At5g03820.1 68418.m00351 GDSL-motif lipase/hydrolase family prot... 29 9.1 At4g37180.2 68417.m05264 myb family transcription factor contain... 29 9.1 At4g37180.1 68417.m05263 myb family transcription factor contain... 29 9.1 At3g45130.1 68416.m04871 cycloartenol synthase, putative / 2,3-e... 29 9.1 At3g20770.1 68416.m02627 ethylene-insensitive 3 (EIN3) identical... 29 9.1 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 9.1 At3g13280.1 68416.m01672 expressed protein contains Pfam profile... 29 9.1 At1g32460.1 68414.m04006 expressed protein 29 9.1 >At5g62110.1 68418.m07796 hypothetical protein Length = 691 Score = 35.5 bits (78), Expect = 0.14 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 13/128 (10%) Query: 136 FENSNDDHRNIGTVELYSEDRENPIYGTKIHKGKIREPTRFNYTENNTFPSQEIYQNYA- 194 F N N RN ED N H+G++ F + +N F I Y+ Sbjct: 472 FANDNQLERNAILAGYSIEDINN--LSINNHQGQVLSGVNFEFANDNQFERNAILAGYSI 529 Query: 195 ----NMPM--ITD-THETTADGDTKSNNPDKNIQNQNSVNKFNTNENNAVQNTHNPIKFQ 247 N+ + + D ++E T + +N + I + N++N+ N N N + T N I Sbjct: 530 EDINNLSINNVNDNSNEETLNSIAANNEMNFTILDVNTINQVNGNSN---EETLNSIVAN 586 Query: 248 KVVDFTNL 255 ++FT L Sbjct: 587 SEINFTTL 594 >At3g19210.1 68416.m02438 DNA repair protein RAD54, putative similar to RAD54 GB:CAA71278 from [Drosophila melanogaster] (Mol. Cell. Biol.(1997) 17 (10), 6097-6104) Length = 852 Score = 34.7 bits (76), Expect = 0.24 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Query: 177 NYTENNTFPSQEIYQNYANMPMITDTHETTADGDTKSNNPDKNIQNQNSVNKFNTNENNA 236 N+T + +++Y P+I E TA + K+ D++ + + VN+F NA Sbjct: 262 NFTNPGSLGDAAHFRHYYEAPIICG-REPTATEEEKNLAADRSAELSSKVNQFILRRTNA 320 Query: 237 VQNTHNPIKFQKVV 250 + + H P K +VV Sbjct: 321 LLSNHLPPKIIEVV 334 >At1g22870.1 68414.m02855 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 913 Score = 34.3 bits (75), Expect = 0.32 Identities = 26/118 (22%), Positives = 43/118 (36%) Query: 125 PNNFNYFNSQTFENSNDDHRNIGTVELYSEDRENPIYGTKIHKGKIREPTRFNYTENNTF 184 P N FN+ T ++ + + ++ T + P + TR N T Sbjct: 680 PANSPQFNNSTVQSQSSNRTSVPTTCPAVDLEWPPRQSFNATAQPANDETRINAAGTPTT 739 Query: 185 PSQEIYQNYANMPMITDTHETTADGDTKSNNPDKNIQNQNSVNKFNTNENNAVQNTHN 242 PS + +AN P ++ T + G S I N S + N + Q T+N Sbjct: 740 PSFDELDPFANWPPRPNSASTASGGFHNSTTTQPPINNSGSGLRNNLTDGRQFQTTNN 797 >At4g17695.1 68417.m02643 myb family transcription factor (KAN3) contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA GARP-like putative transcription factor KANADI3 (KAN3) GI:15723596 Length = 322 Score = 33.9 bits (74), Expect = 0.42 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 5/100 (5%) Query: 102 FATQAFDGVNDNDGQKSGVLQYNPNNFNYFNSQTFENSNDDHRNIGTVELYSEDRENPIY 161 F ++A D N + LQ+ NN T NSN +H+ +L S PI Sbjct: 40 FQSKASDLDNKSSNNLIHTLQFTSNN-----EATKINSNQEHKESLDQDLRSIFMMRPIR 94 Query: 162 GTKIHKGKIREPTRFNYTENNTFPSQEIYQNYANMPMITD 201 G +++ ++ + ++ T N F E+ +A+ +IT+ Sbjct: 95 GIPLYQNQVLDHYYYSSTSPNPFFFSEVNGQHASRRLITN 134 >At1g77500.1 68414.m09025 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 879 Score = 33.5 bits (73), Expect = 0.56 Identities = 35/156 (22%), Positives = 62/156 (39%), Gaps = 10/156 (6%) Query: 69 TGFSSAGVNQESSTRLYAPAFPTALDATDFGNNFATQAFDGVNDNDGQKSGVLQYNPNNF 128 +GF + GV + S + L P+ PT + DF N F T D +S Y P Sbjct: 232 SGFRNTGVQRRSPSPLPPPSPPT-VSTWDFLNVFDTY------DYSNARSRASGYYPMGM 284 Query: 129 NYFNSQTFENSNDDHRNIGTVELYSEDRE-NPIYGTKIHKGKIREPTRFNYTENNTFPSQ 187 +S + I +E +E +Y G + + ++N FP + Sbjct: 285 ASISSSPDSKEVREREGIPELEEVTEQEVIKQVYRRPKRPGLEKVKEHRDEHKHNVFPER 344 Query: 188 EIYQNYANMPMITDTHETTADGDTKSNNPDKNIQNQ 223 I N +PM E++ D +T S+ +++++ Sbjct: 345 NI--NKREVPMPEQVTESSLDSETISSFSGSDVESE 378 >At1g20720.1 68414.m02596 helicase-related similar to BRCA1-binding helicase-like protein BACH1 (GI:13661819) Homo sapiens].; Length = 1169 Score = 33.1 bits (72), Expect = 0.74 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Query: 211 TKSNNPDKNIQNQNSVNKFNTNENNAVQNTHNPIKFQKVVDFTNLKPHYPISFHSISTTT 270 ++ ++ +KN ++ +F EN +QN + ++ KV D+TN P Y + S + Sbjct: 789 SQEDSVEKNFSSEKQSKEFRRKENQ-IQNKSSQVE-PKVEDYTNSNPKYHFMYESKAFGY 846 Query: 271 PRDI 274 RD+ Sbjct: 847 HRDV 850 >At5g36740.1 68418.m04402 PHD finger family protein Length = 1179 Score = 32.7 bits (71), Expect = 0.97 Identities = 35/161 (21%), Positives = 64/161 (39%), Gaps = 6/161 (3%) Query: 76 VNQESSTRLYAPAFPTALDATDFGNNFATQAFDGVNDNDGQKSGVLQ-YNPNNFNYFNSQ 134 V+ + L AP +D + N ++ D ++ + +GV NP + + Sbjct: 969 VSSPNGLVLLAPEMTLPVDVEE---NKPEESKDSAHERNCATAGVESPSNPVDSCLKLTY 1025 Query: 135 TFENSNDDHRNIGTVELYSEDRENPIYGTKIHKGKIREPTRFNYTENNTFPSQEIYQNYA 194 E ND N+ ++ E++E+ T I + + ++ + + QEI Sbjct: 1026 VEEGDNDRESNLKLLDGSVEEKEDTKKLTDIDINSLPDEVDDSHADQSDTKEQEIDDKED 1085 Query: 195 NMPMITDTHETTADGDTKSN-NPDKN-IQNQNSVNKFNTNE 233 P+ D E A+G +SN PD N + N + T E Sbjct: 1086 KTPLSDDGCEGKAEGTKESNQQPDSNKVDNSQPLGNGGTGE 1126 >At5g36670.1 68418.m04388 PHD finger family protein Length = 1193 Score = 32.7 bits (71), Expect = 0.97 Identities = 35/161 (21%), Positives = 64/161 (39%), Gaps = 6/161 (3%) Query: 76 VNQESSTRLYAPAFPTALDATDFGNNFATQAFDGVNDNDGQKSGVLQ-YNPNNFNYFNSQ 134 V+ + L AP +D + N ++ D ++ + +GV NP + + Sbjct: 983 VSSPNGLVLLAPEMTLPVDVEE---NKPEESKDSAHERNCATAGVESPSNPVDSCLKLTY 1039 Query: 135 TFENSNDDHRNIGTVELYSEDRENPIYGTKIHKGKIREPTRFNYTENNTFPSQEIYQNYA 194 E ND N+ ++ E++E+ T I + + ++ + + QEI Sbjct: 1040 VEEGDNDRESNLKLLDGSVEEKEDTKKLTDIDINSLPDEVDDSHADQSDTKEQEIDDKED 1099 Query: 195 NMPMITDTHETTADGDTKSN-NPDKN-IQNQNSVNKFNTNE 233 P+ D E A+G +SN PD N + N + T E Sbjct: 1100 KTPLSDDGCEGKAEGTKESNQQPDSNKVDNSQPLGNGGTGE 1140 >At4g09960.2 68417.m01630 MADS-box protein (AGL11) Length = 216 Score = 32.7 bits (71), Expect = 0.97 Identities = 35/144 (24%), Positives = 61/144 (42%), Gaps = 10/144 (6%) Query: 380 SHGKRYEYSNNNINMT---FKYESNESRNPLNNIDEIVPA--SSNLVDLNYPQQQIFSTF 434 + G+ YEY+NNNI T +K ++S N + + EI A L Q I ++ Sbjct: 50 TRGRLYEYANNNIRSTIERYKKACSDSTN-TSTVQEINAAYYQQESAKLRQQIQTIQNSN 108 Query: 435 KKMPEISFSDYSSIKSFKDSQQKLNDFSNAYRXXXXXXXXXXXYWGNTYEVTELPSFKKH 494 + + S S S+K K + +L + R + T +V E+ +++H Sbjct: 109 RNLMGDSLSSL-SVKELKQVENRLEKAISRIRSKKEIELDNENIYLRT-KVAEVERYQQH 166 Query: 495 PH--FSDDLDDEIVSIPKRNKYHH 516 H S + I ++ RN + H Sbjct: 167 HHQMVSGSEINAIEALASRNYFAH 190 >At2g33350.1 68415.m04088 hypothetical protein Length = 440 Score = 31.9 bits (69), Expect = 1.7 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 8/107 (7%) Query: 176 FNYTENNTFPSQEIYQNYANMPMITDTHETTADGDTKSNNPDKNIQNQNSVNKFNTNEN- 234 FN + T S I + + T+T TT + + +NN + N+Q+ N NT+ + Sbjct: 70 FNQSSEVTSTSN-ILEKSGSFHSNTNTTTTTENSNNNNNNKNTNLQDDEDDNN-NTDLSI 127 Query: 235 --NAVQNTHNPIKFQKVVDFTNLKPHYPISFHSISTTTPRDIIDYGS 279 ++ ++ N I +DF++ YP+ H + T +D D+ S Sbjct: 128 IFDSQEDFENDITAS--IDFSSSSLQYPVIDH-LLTAISQDQFDFSS 171 >At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 516 Score = 31.5 bits (68), Expect = 2.2 Identities = 35/124 (28%), Positives = 54/124 (43%), Gaps = 14/124 (11%) Query: 212 KSNNPDKNIQNQNSVNKFNT---NENNAVQNTHNPIKFQKVVDFTNLKPH-YPISFHSIS 267 +S+NP+ IQ+ +S NT N N + N H I+F VD NLK SF ++ Sbjct: 282 QSSNPNFLIQSASSQGMLNTTPNNNNQSFMNQHGLIQFDP-VDNINLKSSGTNNSFFNLG 340 Query: 268 TTTPRDIIDYGSLPHSHSGNAYENAVSENNSQMVKSGSNINGKYNFNK-----HININDD 322 SLP +S + + EN + +GSN++ K + ND Sbjct: 341 FFQENTKNSETSLPSLYSTDVLVHHREEN----LNAGSNVSATALLQKATQMGSVTSNDP 396 Query: 323 NAIF 326 +A+F Sbjct: 397 SALF 400 >At4g34430.4 68417.m04893 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 986 Score = 31.1 bits (67), Expect = 3.0 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 5/114 (4%) Query: 132 NSQTFENSNDDHRNIGTVELYSEDRENPIYGT-KIHKGKIREPTR-FNYTENNTFPSQEI 189 NS + + + V L S+DRE P T K + + E + + TEN+T + Sbjct: 616 NSHKDDQPEEKSKKAEEVSLNSDDREMPDTDTGKETQDSVSEEKQPGSRTENSTTKLDAV 675 Query: 190 YQNYANMPMITDTHETTADGDTKSNN--PDKNIQNQ-NSVNKFNTNENNAVQNT 240 + ++ P+ TD E D S + K +Q NK ++ +A Q+T Sbjct: 676 QEKRSSKPVTTDNSEKPVDIICPSQDKCSGKELQEPLKDGNKLSSENKDASQST 729 >At4g34430.3 68417.m04892 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 983 Score = 31.1 bits (67), Expect = 3.0 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 5/114 (4%) Query: 132 NSQTFENSNDDHRNIGTVELYSEDRENPIYGT-KIHKGKIREPTR-FNYTENNTFPSQEI 189 NS + + + V L S+DRE P T K + + E + + TEN+T + Sbjct: 614 NSHKDDQPEEKSKKAEEVSLNSDDREMPDTDTGKETQDSVSEEKQPGSRTENSTTKLDAV 673 Query: 190 YQNYANMPMITDTHETTADGDTKSNN--PDKNIQNQ-NSVNKFNTNENNAVQNT 240 + ++ P+ TD E D S + K +Q NK ++ +A Q+T Sbjct: 674 QEKRSSKPVTTDNSEKPVDIICPSQDKCSGKELQEPLKDGNKLSSENKDASQST 727 >At4g34430.2 68417.m04891 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 985 Score = 31.1 bits (67), Expect = 3.0 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 5/114 (4%) Query: 132 NSQTFENSNDDHRNIGTVELYSEDRENPIYGT-KIHKGKIREPTR-FNYTENNTFPSQEI 189 NS + + + V L S+DRE P T K + + E + + TEN+T + Sbjct: 616 NSHKDDQPEEKSKKAEEVSLNSDDREMPDTDTGKETQDSVSEEKQPGSRTENSTTKLDAV 675 Query: 190 YQNYANMPMITDTHETTADGDTKSNN--PDKNIQNQ-NSVNKFNTNENNAVQNT 240 + ++ P+ TD E D S + K +Q NK ++ +A Q+T Sbjct: 676 QEKRSSKPVTTDNSEKPVDIICPSQDKCSGKELQEPLKDGNKLSSENKDASQST 729 >At4g34430.1 68417.m04890 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 985 Score = 31.1 bits (67), Expect = 3.0 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 5/114 (4%) Query: 132 NSQTFENSNDDHRNIGTVELYSEDRENPIYGT-KIHKGKIREPTR-FNYTENNTFPSQEI 189 NS + + + V L S+DRE P T K + + E + + TEN+T + Sbjct: 616 NSHKDDQPEEKSKKAEEVSLNSDDREMPDTDTGKETQDSVSEEKQPGSRTENSTTKLDAV 675 Query: 190 YQNYANMPMITDTHETTADGDTKSNN--PDKNIQNQ-NSVNKFNTNENNAVQNT 240 + ++ P+ TD E D S + K +Q NK ++ +A Q+T Sbjct: 676 QEKRSSKPVTTDNSEKPVDIICPSQDKCSGKELQEPLKDGNKLSSENKDASQST 729 >At5g08520.1 68418.m01011 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 298 Score = 30.7 bits (66), Expect = 3.9 Identities = 30/135 (22%), Positives = 53/135 (39%), Gaps = 7/135 (5%) Query: 108 DGVNDNDGQKSGVLQYNPNNFNYFNSQTFENSNDDHRNIGTVELYSEDRENPIYGTKIHK 167 +G N + G + + N+ ++Q ++ +D R G E R + K K Sbjct: 78 EGSNGHAGDEGASSKKGGNSHAGESNQAGKSKSDQERRKGIAWTEDEHRLFLLGLDKYGK 137 Query: 168 GKIREPTR-FNYTENNTFPSQEIYQNYANMPMI------TDTHETTADGDTKSNNPDKNI 220 G R +R F T T + + + + + + H+ T+ G+ + P I Sbjct: 138 GDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRRRSSIHDITSVGNADVSTPQGPI 197 Query: 221 QNQNSVNKFNTNENN 235 QN+ N N N NN Sbjct: 198 TGQNNSNNNNNNNNN 212 >At5g07340.1 68418.m00838 calnexin, putative identical to calnexin homolog 2 from Arabidopsis thaliana [SP|Q38798], strong similarity to calnexin homolog 1, Arabidopsis thaliana, EMBL:AT08315 [SP|P29402]; contains Pfam profile PF00262 calreticulin family Length = 532 Score = 29.9 bits (64), Expect = 6.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Query: 6 IYILFIALFYLYISAEAKKSKKNRRPYVDEETSTPQA 42 I I+F++LF+ I AK + ++P ETST +A Sbjct: 475 IVIVFLSLFFKLIFGGAKAKVEKKKPETAAETSTSEA 511 >At4g14620.1 68417.m02250 expressed protein contains Pfam profile PF04720: Protein of unknown function (DUF506) Length = 341 Score = 29.9 bits (64), Expect = 6.9 Identities = 14/46 (30%), Positives = 26/46 (56%) Query: 290 ENAVSENNSQMVKSGSNINGKYNFNKHININDDNAIFSNHYSLNSV 335 +N + ENN + K+G N + FN + +I+DD F ++ + S+ Sbjct: 67 QNYMEENNDKQTKNGRNTHRCNCFNGNNDISDDELDFFDYDNFKSL 112 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 29.9 bits (64), Expect = 6.9 Identities = 25/118 (21%), Positives = 51/118 (43%), Gaps = 7/118 (5%) Query: 210 DTKSNNPDKNIQNQNSVNKFNTNENNAVQNTHNPIKFQKVVDFTNLKPHYPISFHSISTT 269 +T NN + N + N+ NK + N+ +T P + F N + +YP + T Sbjct: 88 ETTYNNNNDNKEEFNNNNKNDEKVNSKTFST--PSLSETEESFNNYEENYPKKTENYGTK 145 Query: 270 TPRDIIDYGSLPHSHSGNAYE----NAVSENNSQMVKSGSNINGKYNFNKHININDDN 323 + ++ + + + N E N EN ++ + +N N YN+ N+ +++ Sbjct: 146 GYNNE-EFNNNNNKYDANFKEEFNNNKYDENYAKEEFNNNNNNNNYNYKYDENVKEES 202 >At5g03820.1 68418.m00351 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL3 (GI:15054386) and EXL1 (GI:15054382), EXL2 (GI:15054384) [Arabidopsis thaliana]; contains Pfam profile PF00657: Lipase/Acylhydrolase with GDSL-like motif Length = 354 Score = 29.5 bits (63), Expect = 9.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 206 TADGDTKSNNPDKNIQNQNSVNKFNTNENNAVQNTHNPIKFQKVVDFTNLKP 257 T G+T +NN NQ++V+ FNT NN N N + K+V F P Sbjct: 229 TLFGETGNNNTCVERLNQDAVS-FNTKLNNTSMNLTNNLPGLKLVVFDIYNP 279 >At4g37180.2 68417.m05264 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 363 Score = 29.5 bits (63), Expect = 9.1 Identities = 19/98 (19%), Positives = 38/98 (38%) Query: 200 TDTHETTADGDTKSNNPDKNIQNQNSVNKFNTNENNAVQNTHNPIKFQKVVDFTNLKPHY 259 TD + +NP+ ++ N + N Q + P + + F P Sbjct: 114 TDKKSWMSSAQLWISNPNSQFRSTNEEEEDRCVSQNPFQTCNYPNQGGVFMPFNRPPPPP 173 Query: 260 PISFHSISTTTPRDIIDYGSLPHSHSGNAYENAVSENN 297 P + S+ T T ++DY + SH + + S+++ Sbjct: 174 PPAPLSLMTPTSEMMMDYSRIEQSHHHHQFNKPSSQSH 211 >At4g37180.1 68417.m05263 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 356 Score = 29.5 bits (63), Expect = 9.1 Identities = 19/98 (19%), Positives = 38/98 (38%) Query: 200 TDTHETTADGDTKSNNPDKNIQNQNSVNKFNTNENNAVQNTHNPIKFQKVVDFTNLKPHY 259 TD + +NP+ ++ N + N Q + P + + F P Sbjct: 107 TDKKSWMSSAQLWISNPNSQFRSTNEEEEDRCVSQNPFQTCNYPNQGGVFMPFNRPPPPP 166 Query: 260 PISFHSISTTTPRDIIDYGSLPHSHSGNAYENAVSENN 297 P + S+ T T ++DY + SH + + S+++ Sbjct: 167 PPAPLSLMTPTSEMMMDYSRIEQSHHHHQFNKPSSQSH 204 >At3g45130.1 68416.m04871 cycloartenol synthase, putative / 2,3-epoxysqualene--cycloartenol cyclase, putative / (S)-2,3-epoxysqualene mutase, putative 77% similar to cycloartenol synthase [SP|P38605|gi:452446] [PMID: 7505443]; oxidosqualene cyclase LcOSC2 - Luffa cylindrica, EMBL:AB033335 Length = 748 Score = 29.5 bits (63), Expect = 9.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Query: 417 SSNLVDLNYPQQQIFSTFKKMPEISFSDYSSI 448 +S + D +YPQQ+I F + IS+S Y +I Sbjct: 701 NSQMEDGDYPQQEILGVFNRNCMISYSAYRNI 732 >At3g20770.1 68416.m02627 ethylene-insensitive 3 (EIN3) identical to ethylene-insensitive3 GI:2224933 from [Arabidopsis thaliana] Length = 628 Score = 29.5 bits (63), Expect = 9.1 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 6/73 (8%) Query: 172 EPTRFNYTENNTFPSQEIYQNYANMPMITDTHETTADGDTKSNNPD--KNIQNQNSVNKF 229 +PT N+ E+ FP + ++ I + A+ + SNN + N N+V KF Sbjct: 507 QPTVHNHQEHLQFPGNMVEGSFFEDLNIPNR----ANNNNSSNNQTFFQGNNNNNNVFKF 562 Query: 230 NTNENNAVQNTHN 242 +T ++N + HN Sbjct: 563 DTADHNNFEAAHN 575 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 9.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 208 DGDTKSNNPDKNIQNQNSVNKFNTNENNAVQNTH 241 DG+ +NN D N N + N N N NN N + Sbjct: 74 DGNNGNNNNDNNNNNNGNNNNDNNNGNNKDNNNN 107 >At3g13280.1 68416.m01672 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537; expression supported by MPSS Length = 383 Score = 29.5 bits (63), Expect = 9.1 Identities = 24/85 (28%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Query: 91 TALDATDFGNNFATQAFDGVNDNDGQKSGVLQYNPNNFN-YFNSQTFENSNDDHRNIGTV 149 T +DA F FDG N G S +++ P N F S T E R + T Sbjct: 258 TLVDAKTFKELCKMLEFDGKTCNKGNGSTMVKIRPEEGNPCFTSVTMEECMMMMRKLKTE 317 Query: 150 E--LYSEDRENPIYGTKIHKGKIRE 172 E + E+ E PI ++ + E Sbjct: 318 EAAVEEENPEKPIQSIQVQRSSATE 342 >At1g32460.1 68414.m04006 expressed protein Length = 92 Score = 29.5 bits (63), Expect = 9.1 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Query: 406 PLNNIDEIVPASSNLVDLNY--PQQQIFSTFKKMPEISFSDYSSIKSFKDSQQKLND 460 P NN A +L++++Y P++ T+ + +++ S K KD +KL D Sbjct: 4 PRNNKTSQEQARESLIEISYTSPEEDEVITYSDVKPVTYISNGSAKGNKDDAEKLRD 60 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.312 0.130 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,776,918 Number of Sequences: 28952 Number of extensions: 787460 Number of successful extensions: 1770 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 19 Number of HSP's that attempted gapping in prelim test: 1719 Number of HSP's gapped (non-prelim): 73 length of query: 790 length of database: 12,070,560 effective HSP length: 87 effective length of query: 703 effective length of database: 9,551,736 effective search space: 6714870408 effective search space used: 6714870408 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -