BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000416-TA|BGIBMGA000416-PA|IPR009533|Protein of unknown function DUF1151 (194 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 25 0.52 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 25 0.52 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 25 0.52 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 6.5 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 24.6 bits (51), Expect = 0.52 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 91 QRMDLHRELLFNQRIGKNVLNQKSELEKALSKHKEKQILNQMREQQH 137 +RM L +EL + I + ++ E E+ + +EKQ ++ +Q H Sbjct: 57 RRMKLKKELRAVKEINEQARREREEQERHKQQQQEKQ--QKIEQQTH 101 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 24.6 bits (51), Expect = 0.52 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 91 QRMDLHRELLFNQRIGKNVLNQKSELEKALSKHKEKQILNQMREQQH 137 +RM L +EL + I + ++ E E+ + +EKQ ++ +Q H Sbjct: 208 RRMKLKKELRAVKEINEQARREREEQERHKQQQQEKQ--QKIEQQTH 252 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 24.6 bits (51), Expect = 0.52 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 91 QRMDLHRELLFNQRIGKNVLNQKSELEKALSKHKEKQILNQMREQQH 137 +RM L +EL + I + ++ E E+ + +EKQ ++ +Q H Sbjct: 267 RRMKLKKELRAVKEINEQARREREEQERHKQQQQEKQ--QKIEQQTH 311 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.0 bits (42), Expect = 6.5 Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 1 MKTFVVGFFG 10 MKTFV+ FFG Sbjct: 1 MKTFVILFFG 10 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.130 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,467 Number of Sequences: 317 Number of extensions: 1120 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 194 length of database: 114,650 effective HSP length: 54 effective length of query: 140 effective length of database: 97,532 effective search space: 13654480 effective search space used: 13654480 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.4 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -