BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000415-TA|BGIBMGA000415-PA|IPR009091|Regulator of chromosome condensation/beta-lactamase-inhibitor protein II, IPR000408|Regulator of chromosome condensation, RCC1 (993 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 28 1.4 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 7.4 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 27.9 bits (59), Expect = 1.4 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Query: 660 GCGGDFTVYIDDDGRI--YSTGNTHLQISNEK-TKGGNRVIMMKT 701 G D ++ D G I YSTG +QI+N+K T G+R I+ +T Sbjct: 9 GAPDDANCHVGDLGNIVAYSTGLAKIQIANKKLTLVGDRSIIGRT 53 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/18 (55%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Query: 475 LLTRGGELWACG-ASVFG 491 + T GG LWACG +FG Sbjct: 346 IATIGGSLWACGQTGIFG 363 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,002,410 Number of Sequences: 2123 Number of extensions: 41150 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 74 Number of HSP's gapped (non-prelim): 2 length of query: 993 length of database: 516,269 effective HSP length: 71 effective length of query: 922 effective length of database: 365,536 effective search space: 337024192 effective search space used: 337024192 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -