BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000415-TA|BGIBMGA000415-PA|IPR009091|Regulator of chromosome condensation/beta-lactamase-inhibitor protein II, IPR000408|Regulator of chromosome condensation, RCC1 (993 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 25 3.4 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 25 3.4 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 4.4 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 7.8 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/37 (27%), Positives = 15/37 (40%) Query: 418 HYHSAAVDAGGRLLTWGWGVHGQLGLGNIDDQWTPQL 454 H + A A + +W G H +G W PQ+ Sbjct: 13 HQQAVAAPANAPMHSWYAGYHQGAQMGPEQQMWEPQM 49 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/37 (27%), Positives = 15/37 (40%) Query: 418 HYHSAAVDAGGRLLTWGWGVHGQLGLGNIDDQWTPQL 454 H + A A + +W G H +G W PQ+ Sbjct: 13 HQQAVAAPANAPMHSWYAGYHQGAQMGPEQQMWEPQM 49 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/38 (28%), Positives = 17/38 (44%) Query: 943 ELERVLRKYMESNATTMITAILYSKDCSEYSEILSPKF 980 EL R+ R Y N + + + +DC Y +S F Sbjct: 303 ELGRIFRAYCRENHASWVNHLSNIEDCLNYVPHISTGF 340 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Query: 786 YHNNAYSECLRLMLENLKRGPQNDCF 811 Y NN S + +ENLK P N F Sbjct: 427 YLNNEGSLVYNVQIENLKTTPDNTTF 452 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,274 Number of Sequences: 317 Number of extensions: 8998 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 5 length of query: 993 length of database: 114,650 effective HSP length: 64 effective length of query: 929 effective length of database: 94,362 effective search space: 87662298 effective search space used: 87662298 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -