Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000413-TA|BGIBMGA000413-PA|undefined
         (216 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          21   6.7  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 103 SPEKRGPKHSFKDKLDDFTFAAIRT---LFDGASDTF----EKLKSIERKEGI 148
           +P+K GP  S+ D+  +    A+RT     + AS  F      L  I R+EGI
Sbjct: 455 TPKKDGPTKSWSDESLNNALDALRTGTISANKASKAFGIPSSTLYKIARREGI 507


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.134    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,983
Number of Sequences: 429
Number of extensions: 2783
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 216
length of database: 140,377
effective HSP length: 55
effective length of query: 161
effective length of database: 116,782
effective search space: 18801902
effective search space used: 18801902
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 42 (21.0 bits)