BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000413-TA|BGIBMGA000413-PA|undefined (216 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37510.1 68417.m05307 ribonuclease III family protein contain... 33 0.15 At4g19130.1 68417.m02823 replication protein-related similar to ... 31 0.60 At3g43930.1 68416.m04702 expressed protein predicted proteins, A... 30 1.0 At2g37990.1 68415.m04663 ribosome biogenesis regulatory protein ... 30 1.0 At1g75330.1 68414.m08750 ornithine carbamoyltransferase, chlorop... 30 1.0 At1g70950.1 68414.m08185 expressed protein 30 1.4 At3g49610.1 68416.m05422 hypothetical protein contains Pfam prof... 29 2.4 At5g63410.1 68418.m07960 leucine-rich repeat transmembrane prote... 29 3.2 At3g61540.1 68416.m06893 peptidase family protein similar to pro... 29 3.2 At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) co... 28 4.2 At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding famil... 28 4.2 At5g39380.1 68418.m04771 calmodulin-binding protein-related has ... 28 5.6 At5g50160.1 68418.m06212 ferric reductase-like transmembrane com... 27 7.4 At5g44150.1 68418.m05403 expressed protein 27 7.4 At4g34060.1 68417.m04833 expressed protein similar to DEMETER pr... 27 7.4 At3g05060.1 68416.m00549 SAR DNA-binding protein, putative stron... 27 7.4 At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOA... 27 9.7 At3g19670.1 68416.m02492 FF domain-containing protein / WW domai... 27 9.7 At1g09970.2 68414.m01124 leucine-rich repeat transmembrane prote... 27 9.7 At1g09970.1 68414.m01123 leucine-rich repeat transmembrane prote... 27 9.7 >At4g37510.1 68417.m05307 ribonuclease III family protein contains Pfam profile PF00636 RNase3 domain Length = 537 Score = 33.1 bits (72), Expect = 0.15 Identities = 36/135 (26%), Positives = 55/135 (40%), Gaps = 7/135 (5%) Query: 29 SPRKKRTRIALSVTEKVMIQNVYKHVFEEKAASLLPIEAPEK-KECVSKTADISGIGVTS 87 SP RI S ++ + F K S+L + + C S TA+ G+ S Sbjct: 7 SPSSSLLRICSSSAPEISFSSSISQ-FPSKTQSILTKSRFQNLRICASVTAETQGLPRDS 65 Query: 88 VYSVLKEHKENEQFKSPEKRGPKHSF--KDKLDDFTFAAIRTLFDG--ASDTFEKLKSIE 143 +LKE + + P+K+ P F + LDD A R L + +F L S Sbjct: 66 PQRLLKELAQRKTATGPKKKVPPKRFILRPPLDDKKLAE-RFLNSPQLSLKSFPLLSSCL 124 Query: 144 RKEGIYYQDETWINE 158 + D+TWI+E Sbjct: 125 PSSKLNNADKTWIDE 139 >At4g19130.1 68417.m02823 replication protein-related similar to replication protein A 70kDa [Oryza sativa] GI:13536993; contains Pfam profile PF00098: Zinc knuckle Length = 461 Score = 31.1 bits (67), Expect = 0.60 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query: 79 DISGIGVTSVYSVLKEHKENEQFKSPEKR--GPKHSFKDKLDDFTFA 123 +I GI +Y V EHK+ E+F+ ++ K++FK K+ + TF+ Sbjct: 270 EIMGISAKDLYYVKNEHKDEEKFEDIIRKVAFTKYNFKLKVKEETFS 316 >At3g43930.1 68416.m04702 expressed protein predicted proteins, Arabidopsis thaliana; expression supported by MPSS Length = 404 Score = 30.3 bits (65), Expect = 1.0 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 13/112 (11%) Query: 41 VTEKVMIQNVYKHVFEEKAASLLPIE-----APEKKECVSKTADISGIGVTSVYSVLKEH 95 +TE ++ VYK+ F LLPI+ P + S+T + ++Y+ +E+ Sbjct: 281 LTESERMELVYKNHF---ITLLLPIDWYGEMGPSSRSYFSETGFTCQQILQNIYAFYQEN 337 Query: 96 KENEQFKSPEKRGPKHSFKDKLDDFTFAAIRTLFD-----GASDTFEKLKSI 142 E+ K+ +HS K + D +T+F G+ FE LK + Sbjct: 338 MSEEELKAAIHTNSRHSEKLRAADSVMKGGKTVFKRIQFLGSEKGFEMLKRV 389 >At2g37990.1 68415.m04663 ribosome biogenesis regulatory protein (RRS1) family protein contains Pfam profile PF04939: Ribosome biogenesis regulatory protein (RRS1); similar to Ribosome biogenesis regulatory protein homolog (Swiss-Prot:Q15050) [Homo sapiens] Length = 318 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 59 AASLLPI---EAPEKKECVSKTADISGIGVTSVYSVLKEHKENEQFKSPEKRGPKHSF 113 AA+ LPI +A KK + D++G+ TS S K K+ K P+K+G H + Sbjct: 189 AATSLPISGTKAQPKKIGKDELGDVAGLAATSTASGGKFDKKLPGEKPPKKQGKHHKY 246 >At1g75330.1 68414.m08750 ornithine carbamoyltransferase, chloroplast / ornithine transcarbamylase / OTCase (OTC) identical to SP|O50039 Ornithine carbamoyltransferase, chloroplast precursor (EC 2.1.3.3) (OTCase) (Ornithine transcarbamylase) {Arabidopsis thaliana} Length = 375 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 103 SPEKRGPKHSFKDKL--DDFTFAAIRTLFDGASDTFEKLKSIER 144 SP K KD L DDF A I+T+ D AS+ LKS ER Sbjct: 62 SPSDVKGKSDLKDFLAIDDFDTATIKTILDKASEVKALLKSGER 105 >At1g70950.1 68414.m08185 expressed protein Length = 478 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Query: 19 SSTKHVKPNLSPRKKRTRIALSVTEKVMIQNVYKHVFEEKAASLLPIEAPEKKECVSKTA 78 S K ++ + R + S+T + + + YKH FEE A ++ + +K+ +K + Sbjct: 398 SHNKTEPSKVAQSRSRPATSASITNRAVTRVSYKHGFEE--AEMVKVMVSNRKQSAAKDS 455 Query: 79 DI 80 D+ Sbjct: 456 DL 457 >At3g49610.1 68416.m05422 hypothetical protein contains Pfam profile PF03754: Domain of unknown function (DUF313) Length = 334 Score = 29.1 bits (62), Expect = 2.4 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 13/136 (9%) Query: 18 GSSTKHVKPNLS--PRKKRTRIALSVTEKVMIQNVYKHVFEEKAASLLPIEAPEKKECVS 75 GS H+ +L P+K R+ + T +N H ++SL + E+ E S Sbjct: 86 GSEKSHLDHHLDHLPQKPRSSLECFFTRVYTRRN---HNNVSTSSSLFNTDEFERTETKS 142 Query: 76 KTADISGIGVTSVYSVLKEHKENEQFKSPEKRGPKHSFKDKLDDFTFAAIRTLFDGASDT 135 T S +S S L E+ + ++++S K S K K D F+ A R + D Sbjct: 143 PTIRNSQ---SSPSSCLMENTKRKRYQSSGK-----SKKPKFDPFSLTAARETPEWLLDV 194 Query: 136 FEKLKSIERKEGIYYQ 151 K+K E + Y+ Sbjct: 195 MRKMKGAEGPIKLIYE 210 >At5g63410.1 68418.m07960 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor-like protein kinase Length = 680 Score = 28.7 bits (61), Expect = 3.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 1 MEIVVFICCYIVPYKRYGSSTKHVKPN 27 M ++V +CC + +R G + KHV N Sbjct: 325 MSVLVLVCCVFILLRRKGVTKKHVHHN 351 >At3g61540.1 68416.m06893 peptidase family protein similar to prolyl aminopeptidase (proline iminopeptidase) from Aeromonas sobria SP|P46547, Propionibacterium freudenreichii subsp. shermanii GI:2415704, Hafnia alvei GI:1754489 Length = 515 Score = 28.7 bits (61), Expect = 3.2 Identities = 31/119 (26%), Positives = 43/119 (36%), Gaps = 4/119 (3%) Query: 74 VSKTADISGIGVTSVYSVLKEHKENEQFKSPEKRGPKHSFKDKLDDFTFAAIRTLFDGAS 133 ++ A+ + V EH + F PE R H F LD + T+F A Sbjct: 48 ITSMAEAGSVYVDVAGESKSEHVTGKWFSVPELRLRDHRFIVPLDYSKSSPKITVF--AR 105 Query: 134 DTFEKLKSIERKEGIYYQDETWINEGHAPKKA--WIDQTVSSSRQAFLDGLTTGLKQPL 190 + K + + Y EG P +A WI + R LD TGL PL Sbjct: 106 EIVAVGKEEQAMPYLLYLQGGPGFEGPRPSEASGWIQRACEEFRVVLLDQRGTGLSTPL 164 >At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) contains Pfam profile PF00856: SET domain Length = 1423 Score = 28.3 bits (60), Expect = 4.2 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 14/81 (17%) Query: 84 GVTSVYSVLKEHKENEQFKSPEKRGPKHSFKDKLDDFTFAAIRTLFDGASDTFEKLKSIE 143 G SV + + EH ENE F S K L D+T I+ DGA++T + + Sbjct: 548 GTESVIASISEHVENELFL---------SLKTHLTDYTSILIK---DGANNTTSSARDGK 595 Query: 144 RKEGIYYQDETWINEGHAPKK 164 EG + E + EG + KK Sbjct: 596 MHEGSF--REQYNLEGSSKKK 614 >At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to SP|O14647 Chromodomain-helicase-DNA-binding protein 2 (CHD-2) {Homo sapiens}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 1722 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/41 (31%), Positives = 22/41 (53%) Query: 74 VSKTADISGIGVTSVYSVLKEHKENEQFKSPEKRGPKHSFK 114 VS +++SG + +YS LK+ KE E+ P +F+ Sbjct: 1608 VSTFSNLSGDRLNQIYSKLKQEKEEEEGVGPSHLNGSRNFQ 1648 >At5g39380.1 68418.m04771 calmodulin-binding protein-related has weak similarity to calmodulin-binding proteins Length = 507 Score = 27.9 bits (59), Expect = 5.6 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 87 SVYSVLKEHKENEQFKSPEKRGPKHSFKDKLDDFTFAAIRTLFDGASDTFEKLKSIERKE 146 S + + K K + P + K FK LDD TL G+S +K++ +E+ E Sbjct: 52 SCHDLCKYGKRQIPVEKPWRSSTKKIFKKSLDD---NLNETLKPGSSKMKKKVREVEKNE 108 Query: 147 G 147 G Sbjct: 109 G 109 >At5g50160.1 68418.m06212 ferric reductase-like transmembrane component family protein contains Pfam profile PF01794: Ferric reductase like transmembrane component Length = 728 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Query: 82 GIGVTSVYSVLKEHKENEQFKSPEK 106 GIG+T S+LKE + KSP++ Sbjct: 431 GIGITPFLSILKELASKNRLKSPKR 455 >At5g44150.1 68418.m05403 expressed protein Length = 355 Score = 27.5 bits (58), Expect = 7.4 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 4/78 (5%) Query: 66 EAPEKKECVSKTADISGIGVTSVYSVLKEHKENEQFKSP----EKRGPKHSFKDKLDDFT 121 EA + V+ + S T + S+LK H EQF P +++ F D LDD Sbjct: 267 EAHTQPNPVASASGKSSAFETELDSLLKSHSSTEQFNKPGNPSDQKIHMTGFNDVLDDLL 326 Query: 122 FAAIRTLFDGASDTFEKL 139 + ++ ++ T K+ Sbjct: 327 ESTPVSIIPQSNQTSSKV 344 >At4g34060.1 68417.m04833 expressed protein similar to DEMETER protein [Arabidopsis thaliana] GI:21743571; expression supported by MPSS Length = 1073 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Query: 95 HKENEQFKSPEKRGPKHSFKDKLDD 119 HK+ E+ S EK G KHS + L D Sbjct: 53 HKKKEKKNSKEKHGIKHSESEHLQD 77 >At3g05060.1 68416.m00549 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 27.5 bits (58), Expect = 7.4 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Query: 52 KHVFEEKAASLLPIEAPEKKECVSKTADISGIGVTSVYSVLKE--HKENEQFKSPEKRGP 109 K V EEK P E +KK+ ++T + + K+ H+E E ++P K+ Sbjct: 464 KKVEEEKPEEEEPSEKKKKKKAEAETEAVVEVAKEEKKKNKKKRKHEEEETTETPAKKKD 523 Query: 110 KHSFKDKLDD 119 K K K D Sbjct: 524 KKEKKKKSKD 533 >At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 341 Score = 27.1 bits (57), Expect = 9.7 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query: 6 FICCYIVPYKRYGSSTKHVKPNLSPRKKRTRIALSVTEKVMIQNVYKHVFE 56 FIC +P K + + PNL P K + L+V K+++ V HV+E Sbjct: 94 FICFACLPIKIRQDPSPNAIPNLHP-KPMPKWVLAV--KILVLGVLLHVYE 141 >At3g19670.1 68416.m02492 FF domain-containing protein / WW domain-containing protein weak similarity to huntingtin-interacting protein HYPA/FBP11 [Homo sapiens] GI:3341980; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 960 Score = 27.1 bits (57), Expect = 9.7 Identities = 17/61 (27%), Positives = 28/61 (45%) Query: 11 IVPYKRYGSSTKHVKPNLSPRKKRTRIALSVTEKVMIQNVYKHVFEEKAASLLPIEAPEK 70 I+ YKR+ S +KPN RK + R+ + + + +F+E L E +K Sbjct: 557 IIEYKRFLESCNFIKPNSQWRKVQDRLEVDERCSRLEKIDQLEIFQEYLRDLEREEEEKK 616 Query: 71 K 71 K Sbjct: 617 K 617 >At1g09970.2 68414.m01124 leucine-rich repeat transmembrane protein kinase, putative Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). ESTs gb|ATTS0475,gb|ATTS4362 come from this gene isoform contains a TG acceptor site at intron. Length = 977 Score = 27.1 bits (57), Expect = 9.7 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Query: 136 FEKLKSIERKEGIYYQDETWINEGHAPKKAWIDQTVSSSRQAFL---DGLTTGLKQPLGK 192 F LK E+KEG + E+W + D + S ++ L G + LG Sbjct: 628 FLYLKKTEKKEGRSLKHESWSIKSFRKMSFTEDDIIDSIKEENLIGRGGCGDVYRVVLGD 687 Query: 193 GKRLIISHI 201 GK + + HI Sbjct: 688 GKEVAVKHI 696 >At1g09970.1 68414.m01123 leucine-rich repeat transmembrane protein kinase, putative Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). ESTs gb|ATTS0475,gb|ATTS4362 come from this gene isoform contains a TG acceptor site at intron. Length = 976 Score = 27.1 bits (57), Expect = 9.7 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Query: 136 FEKLKSIERKEGIYYQDETWINEGHAPKKAWIDQTVSSSRQAFL---DGLTTGLKQPLGK 192 F LK E+KEG + E+W + D + S ++ L G + LG Sbjct: 628 FLYLKKTEKKEGRSLKHESWSIKSFRKMSFTEDDIIDSIKEENLIGRGGCGDVYRVVLGD 687 Query: 193 GKRLIISHI 201 GK + + HI Sbjct: 688 GKEVAVKHI 696 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.134 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,312,343 Number of Sequences: 28952 Number of extensions: 223422 Number of successful extensions: 612 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 603 Number of HSP's gapped (non-prelim): 23 length of query: 216 length of database: 12,070,560 effective HSP length: 78 effective length of query: 138 effective length of database: 9,812,304 effective search space: 1354097952 effective search space used: 1354097952 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -